KEGG   Mus musculus (mouse): 76179Help
Entry
76179             CDS       T01002                                 

Gene name
Usp31, 6330567E21Rik, mKIAA1203
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     76179 (Usp31)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   76179 (Usp31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 F2; 7
AA seq 1344 aa AA seqDB search
MSKVTAPGPGPPVAAGGKEKRSFSKRLFRSGRAGGGGGAGGPGPAAPSSPSSARSVGSFM
SRVLKTLSTLSHLSSEGAAPDRGGLRSCFPPGPASAPTPPPCPPPPASPAPPACASEPVP
GVAGLRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPEPESEQPAGRGPHGQGE
VTEQLAHLVRALWTLEYTPQHSRDFKSIVSKNALQYRGNSQHDAQEFLLWLLDRVHEDLN
HAVKQSGQPPLKPPSETDMMPEGPFPVCSTFVQELFQAQYRSSLTCPHCQKQSNTFDPFL
CISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAVPLSGTVARLREAVSMETKIPTDQIVL
TEMYYDGFHRSFSDTDDLETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLNHLKFGL
DHHRLSSPAPTAAKQGRVDLPTRVASDKIVLLVCNRACTGQQGKRFGLPFVLHLEKTVAW
DLLQKEILEKMKYFLRPTVSIQVCPFSLRVVSVVGITYLLPQEEQPLCHPTVERALKSCG
PGGTAHVKLVVEWDKETKDFLFVNTEDEYIPDAESVRLQKEQHHQPQTCTLSQCFQLYTK
EERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLT
GLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQGGHYTAY
CKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCE
HWVSRLPGSKQASVTSAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLS
SRSSVTSPLAVNENCMRPSWSLSAKLQMRSSSPSRFSGDSPIHGSASTLERIGEAGDDKV
SISCFGSLRNLSGSHQEPSDSHNRREHKAVGRAPLAVMEGVFKDDSDPGKLNSSVVDTPS
KNRAQGDHLPPVSDPFDNNNQIAYVDQSDSVDSSPVKEVKPPSHSDSLTKKPESTTKSSP
SSKGTSEPEKNMRKGRPALASQESSLSSPSPSSPVPVKVSMKPARCRSKADSSRTSGRHS
SSSSTQPKKESSPRSQESMSSPSPQKQKSASAFTYSSSSISAKKAPSPVTRGPFPSGKSR
TSDRSLSREGSRQSLGSDRASVTSTSTSKPSSPRVNQARAGDNRVDGKHVRSSSMASLRS
PSTSVRSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTTLLSKKAGGSSVKSVSKNT
ADDKTEKGHQPPGSQQPNTNAVGKEQLVSKDPAKHSLLSARRSKSSQLDSGAPLSPSSRS
TTEKGSKKLSSSMQTSARPSQKPQ
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtaacggcgcccgggcccgggccgccggtggcggcgggcgggaaggagaag
cgctcgttcagcaagcggctgttccggagtggccgcgcggggggcggcggcggcgctggc
ggccccgggccggccgcgccctcgtcgccgtcgtcggcgcgctcggtgggcagtttcatg
agccgcgtcctcaagacgctgtccacgctctcgcacctcagctccgagggcgccgccccg
gaccgcggcggcctccgcagctgcttcccgcccgggccggcctccgcgcccacgccgccg
ccgtgcccgccgccgcccgcctcgcccgcgcctcccgcctgcgcctcggagccggtgccc
ggcgtggcggggctccgcaaccacggcaacacgtgcttcatgaacgccacgctgcagtgc
ctcagtaacaccgagctcttcgccgagtacctggctctgggccagtaccgggcgggccga
ccggagccagagccggagtcggagcagccggcgggccgcgggccgcacggccagggcgag
gtcaccgagcagctggcgcatctggtgcgggcgctctggacgctggagtacaccccgcaa
cacagccgcgacttcaagagtattgtgtcaaagaatgcgttgcagtatcgaggaaattcc
cagcatgatgcccaggagttcctgctctggcttctggatagagttcatgaagacctcaac
catgctgtaaagcagagtggccagcctcctctgaagccaccatcagagacagatatgatg
cctgagggaccttttcctgtgtgtagcacttttgtacaagaactttttcaagcccagtac
agatcttctttgacatgtcctcattgtcagaaacagagcaacacttttgacccttttctg
tgcatttctttgccaattcctctaccccatacaaggcctctctatgtcactgtagtgtat
caagggaaatgttcccactgcatgaggatcggtgtggctgtgcctctgtctgggactgtt
gccagacttcgggaagctgtatccatggagacaaagatccccactgatcagattgtgtta
acagaaatgtactatgatgggttccatcgttccttcagtgacacagatgacctggagaca
gttcatgaaagtgattgcatttttgcctttgagactccagaaatatttagacctgaagga
attcttagtcaaagaggcattcacttaaacaacaatctaaaccacttgaaatttggcttg
gatcatcacagactgtcttccccagcaccaactgcagcaaaacaaggtcgagtagacttg
cccaccagagtggcaagcgacaagattgttctgcttgtatgtaaccgggcctgcactggg
cagcaagggaaaagatttggactgccctttgtcctgcacctagagaagacagtagcatgg
gaccttctgcagaaggagatcttggagaagatgaagtatttcttgagacctactgtcagc
atccaggtatgcccattcagtttgcgtgtggtcagtgtcgtgggaataacttacttgctg
cctcaggaagaacagcccttgtgccacccaacagtagaaagggcattaaagtcctgtgga
ccaggcggcacagctcatgtgaaactggtagtagaatgggacaaggagacgaaagatttc
ttgtttgtgaacacagaagatgagtatatccctgatgcagagagtgtccgtctgcagaag
gagcagcatcatcagccacaaacctgcactttatcacagtgtttccaactctacaccaag
gaggaacggcttgctccagatgatgcctggaggtgcccacactgcaagcagctgcagcag
gggagcatcacattaagcctgtggactctgcctgatgtgcttattatacacctcaagaga
ttccgccaggaaggagacaggcgtatgaaacttcagaatatggtcaagttccccttgact
ggcctggacatgacacctcatgtggttaagagaagccagagcagctggagcttgccatct
cattggtccccatggcgacggccctatggactcgggagggaccctgaggactacatctat
gacctgtatgctgtgtgcaatcatcatggcaccatgcaaggggggcactacacagcctac
tgtaagaactccgtggatggtctctggtattgcttcgatgatagcgatgtgcagcagctg
tcagaagatgaggtgtgcacgcagacagcttacatccttttctaccagaggcggacagct
atcccatcatggtcagccaatagctcagtggcaggttccacaagttcgtctctgtgtgag
cactgggtgagccggctcccaggaagcaagcaagccagtgtgacttctgcagcctcctcc
agacgcacgtccttggcctctctgtctgagtctgtagagatgacaggggagaggagtgaa
gatgatggaggcttttctactcgaccgttcgtgagaagcgtgcagcgtcaaagcttgtca
tccagatcttctgtcaccagccccttggctgtcaatgaaaattgcatgcggccttcttgg
tccctgtctgccaagctgcagatgcgctccagttctccttcccgcttctcaggggactcc
ccaatccatggatctgcctccacccttgaaaggattggcgaggcaggtgatgacaaagtc
tccatttcttgcttcggtagtctgcggaacctttctggtagtcaccaggaaccaagtgac
agtcacaatagacgagagcacaaggctgtgggccgggccccactggctgtcatggaaggt
gtgttcaaagatgactcagaccctggaaaattgaactccagtgttgtagacacaccaagc
aaaaaccgagcacaaggggatcacttgccccccgtctctgatccttttgataataataac
cagattgcatatgtggaccagagtgattctgttgacagctctccagtcaaagaggtgaaa
cctccaagccactcagattctctcacaaagaagccagagagcacaaccaagagctcccct
agttccaaaggcacttctgagccagagaagaacatgcgcaaggggaggccagccttggct
agccaggaatcttctctgtcaagcccatctccttcttctcctgttcctgtaaaggtttcc
atgaaacctgcccgctgtcggagcaaagcagattcttccaggacaagtggaaggcattca
tcttcctcctctacccaacccaaaaaagaatcttcccccaggtcccaggaatccatgtca
tctccttcaccacagaagcaaaagtctgcttctgcctttacttattcctcctcatccata
tctgccaaaaaagccccaagccctgtcaccaggggccccttcccttctgggaagagcagg
acttctgaccggagcttgagtagagaaggctccagacaaagcttaggctctgacagagcc
agcgtcacctccacctccacctccaaacccagctcccctcgggtgaatcaggccagagca
ggggacaacagagtggatggcaagcacgtccggagctcctccatggccagcctgcgttca
cctagcacaagtgtgcgctctgggttgaagagggacagcaagtctgaggataagggactg
tccttctttaagtcagccttgagacagaaagaaacccggaggtcaactgatcttggcaag
acaaccttgctatccaaaaaggctggtgggagctctgtcaagtcagtcagtaagaacact
gcagatgacaagacagagaaaggccatcagcctcccggctcacagcagccaaacacaaat
gcagttggaaaggaacaacttgtctctaaggaccctgctaaacattccttgctatctgct
cgcagatccaagtcttcccagctagattctggagctcccttgtctcccagtagcaggtcg
accactgagaaaggctccaaaaagctgtcttctagcatgcaaacctctgcacggccttct
caaaaacctcagtga

DBGET integrated database retrieval system