KEGG   Mus musculus (mouse): 76192Help
Entry
76192             CDS       T01002                                 

Gene name
Abhd12, 1500011G07Rik, 6330583M11Rik, AI431047, AW547313
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     76192 (Abhd12)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   76192 (Abhd12)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   76192 (Abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 G3
AA seq 398 aa AA seqDB search
MRKRTEPVTLEHERCAASGSSSSGSAAAALDADCSLKQNLRLAGKGTAEPHSASDAGMKR
ALGRRKSLWFRLRKILLCVLGFYIAIPFLVKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEDDVTIGVWHTIPSVWWKNAQGKDQMWYEDALASNHAIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENMKHISCPLLILHAEDDPVVPFHLGRKLYNIAAPSRSFRDFKVQ
FIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPERQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcaccttggagcatgagcgctgcgccgcctcaggctcg
tcctcctccggctcggccgccgcggcgctggacgccgactgcagcttgaagcagaacctg
cgtctggcgggcaaggggacggcagagccgcacagcgcatccgacgcgggcatgaagcgg
gcgctgggcagacgaaagagcctgtggttccgactaaggaagatacttctctgtgttctg
gggttctacattgccattccatttcttgtcaaactgtgtcctgggatacaggccaaactg
atattcttaaatttcgtgagggttccctatttcattgatttaaaaaaaccacaggatcaa
ggtttgaatcacacctgcaattactacctccagccagaggatgatgtgactattggagtc
tggcacacaatcccctctgtctggtggaagaatgcccaagggaaggaccagatgtggtat
gaggatgctctggcttctaaccatgccatcatactatacctgcatgggaatgcaggcacc
agaggaggtgaccaccgtgtggagctgtacaaggtgctgagttcccttggctaccacgtg
gtcacctttgactacagaggttggggtgactcagtaggaacaccatcggagcgaggcatg
acgtatgacgcactccatgtttttgactggatcaaagcaagaagtggtgataatcctgtg
tatatttggggccattcactgggcaccggagtggcaacaaatctggtacggcgcctctgt
gagcgagagacgccaccagatgcccttatattggagtctccattcacaaatattcgtgaa
gaagcaaagagtcatccattttcagtgatataccgatacttccctggctttgactggttc
ttcctcgaccccattacaagcagtggaattaaatttgcaaatgacgaaaatatgaagcac
atctcctgtcctctgctcatcttgcatgccgaggatgatccagttgtgccctttcatctc
ggtagaaagctatacaacattgctgcaccatctcggagtttccgagacttcaaagtccag
tttatcccctttcactcagaccttggctacagacataaatacatctacaagagcccagag
cttccaaggatactgagggaattcctagggaagtcggaaccggaacgccagcactga

DBGET integrated database retrieval system