KEGG   Mus musculus (mouse): 76267Help
Entry
76267             CDS       T01002                                 

Gene name
Fads1, 0710001O03Rik, A930006B21Rik, AI317215, DSD
Definition
(RefSeq) fatty acid desaturase 1 (EC:1.14.19.-)
  KO
K10224  
acyl-CoA (8-3)-desaturase (Delta-5 desaturase) [EC:1.14.19.44]
Organism
mmu  Mus musculus (mouse)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    76267 (Fads1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    76267 (Fads1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.44  acyl-CoA (8-3)-desaturase
     76267 (Fads1)
Lipid biosynthesis proteins [BR:mmu01004]
 Desaturase
  Front-end
   76267 (Fads1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 A
AA seq 447 aa AA seqDB search
MAPDPVPTPGPASAQLRQTRYFTWEEVAQRSGREKERWLVIDRKVYNISDFSRRHPGGSR
VISHYAGQDATDPFVAFHINKGLVRKYMNSLLIGELAPEQPSFEPTKNKALTDEFRELRA
TVERMGLMKANHLFFLVYLLHILLLDVAAWLTLWIFGTSLVPFILCAVLLSTVQAQAGWL
QHDFGHLSVFGTSTWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPL
FFALGKVLPVELGREKKKHMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVVQRKKWVDLA
WMLSFYARIFFTYMPLLGLKGFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNVDWVS
TQLQATCNVHQSAFNNWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKYGIKYESK
PLLTAFADIVYSLKESGQLWLDAYLHQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgacccggtgccgacccctggcccggcctccgcccagctccgccaaacgcgc
tactttacttgggaggaggtggcgcagcgctccgggcgggagaaggagcgatggctcgtg
atcgaccggaaggtgtacaacatcagcgacttcagccgccgccacccggggggctcccgg
gtcatcagccactacgcgggtcaggatgccacggatccttttgtggcattccacatcaac
aagggtcttgtgagaaagtatatgaactctcttctgattggagagctggctccggagcaa
cccagctttgaacccaccaagaataaagcgctaactgatgaattccgggagctgcgggcc
acagtagagcgaatgggcctcatgaaggccaaccacctcttcttcctggtctacctgctt
cacatcctgctgctggatgtggctgcctggctcaccctttggatctttggaacttccttg
gtgcccttcatcctctgtgcagtactgctcagtacagttcaggctcaggcaggttggcta
cagcatgactttgggcacctgtcagtctttggcacctcgacatggaatcacctgctacat
cattttgtgattggccacctgaagggggcccccgccagctggtggaaccacatgcatttc
cagcaccatgccaagcctaactgcttccgcaaggaccccgatatcaacatgcaccccctc
ttcttcgccctggggaaggtccttcctgtggagctcgggagggaaaagaagaagcacatg
ccatacaaccatcagcacaagtacttcttcctcatcggacccccagccttgctgcctcta
tacttccagtggtatattttctattttgtggttcagcggaaaaaatgggtggacttggcc
tggatgctcagcttctatgcccgcatcttcttcacttacatgccgctgctggggctgaaa
ggcttcctgggccttttcttcattgtcaggttcctggaaagcaactggtttgtgtgggtg
acacagatgaaccatatccccatgcacattgatcacgaccggaatgtggactgggtctcc
acccagctgcaggcaacctgcaacgttcaccaatcagccttcaacaactggttcagtggc
cacctaaatttccagattgaacaccacctcttccccaccatgccgcggcacaactaccac
aaggtggcacccctagtacaatccctgtgcgccaagtacggcatcaagtatgagtccaag
cccctgctcacagccttcgcggacattgtttactccctgaaggagtcagggcaactctgg
ttggacgcttaccttcaccaatag

DBGET integrated database retrieval system