KEGG   Mus musculus (mouse): 76279Help
Entry
76279             CDS       T01002                                 

Gene name
Cyp2d26, 1300006E06Rik
Definition
cytochrome P450, family 2, subfamily d, polypeptide 26 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mmu04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E1; 15
AA seq 500 aa AA seqDB search
MGLLVGDDLWAVVIFTAIFLLLVDLVHRRQRWTACYPPGPVPFPGLGNLLQVDFENIPYS
FYKLQNRYGNVFSLQMAWKPVVVVNGLKAVRELLVTYGEDTSDRPLMPIYNHIGYGHKSK
GVILAPYGPEWREQRRFSVSTLRDFGLGKKSLEQWVTEEAGHLCDAFTKEAEHPFNPSPL
LSKAVSNVIASLIYARRFEYEDPFFNRMLKTLKESLGEDTGFVGEVLNAIPMLLHIPGLP
DKAFPKLNSFIALVNKMLIEHDSTWDPAQPPRDLTDAFLAEVEKAKGNPESSFNDKNLRI
VVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRVHQEIDEVIGHVRHPEMADQARMPYTN
AVIHEVQRFADIVPTNLPHMTSRDIKFQDFFIPKGTTLIPNLSSVLKDETVWEKPLRFYP
EHFLDAQGHFVKHEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPDGQPRPSD
YGIYTMPVTPEPYQLCAVAR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctggttggagatgacttatgggctgtggtcatattcacagccatcttcctg
cttctggtggacctggtgcaccggcgccagcgctggactgcctgctacccaccaggccct
gtgccattccctgggctgggaaacctgctgcaggtggacttcgagaacataccatacagc
ttttacaagcttcaaaaccgctatggcaatgtgttcagcctacagatggcctggaagccc
gtggttgtggtcaacggactgaaggcagtgcgggaactgctggtgacctatggagaggac
acttctgaccgccccctaatgcccatctataatcacataggctatgggcacaaatcaaaa
ggtgtgatccttgcaccttacgggcccgagtggcgagagcagcggcgattttctgtgtct
accctgcgtgacttcggcctgggcaagaaatcactggagcagtgggtgacagaggaggct
ggccacctctgcgatgctttcaccaaggaggccgaacatcccttcaatcccagccccctc
ctaagtaaagctgtgagcaacgtgatcgcctccctcatttatgctcgtcgatttgagtat
gaagaccctttcttcaacaggatgctcaaaacattgaaggaaagcttaggagaagacact
ggcttcgtcggagaggtgctgaatgccatcccaatgctactacacatccctggtttgcct
gataaagccttccccaagctgaattcattcatagccttagtgaataagatgttaattgag
cacgactcgacctgggatcctgcacagccaccccgagatttgactgatgccttcctggct
gaggtggagaaggccaaggggaatcctgagagcagcttcaatgataagaacctgcgcata
gtggtgattgacctgttcatggcagggatggtgaccacctcaaccacactgtcctgggcc
ctgctgctcatgatcctgcatccagatgtgcagcgccgtgtccaccaggaaatcgacgag
gtcatagggcacgtgcggcatccagagatggcagaccaggcccgcatgccctacacaaac
gcggtcattcatgaggtgcaacgctttgcagacatcgtcccaacaaatttaccacatatg
acatcccgagacattaaattccaagacttcttcatccccaaggggacgacactcattccc
aacctgtcctccgtgctgaaggatgagactgtctgggagaagcccctccgcttctatcct
gaacacttcctggatgcccagggccactttgtgaagcacgaggccttcatgccattctca
gcaggccgcagatcatgcctgggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgctttagcttctcagtgcccgatggacagcccagacccagtgat
tatggcatctatacaatgccagttactccagagccctatcagctctgtgcagtggctcga
tag

DBGET integrated database retrieval system