KEGG   Mus musculus (mouse): 76630Help
Entry
76630             CDS       T01002                                 

Gene name
Stambpl1, 1700095N21Rik, 8230401J17Rik, ALMalpha, AMSH-FP
Definition
STAM binding protein like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     76630 (Stambpl1)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M67
   76630 (Stambpl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 C1; 19
AA seq 436 aa AA seqDB search
MEQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNISINEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKTDLLRKYNIEYQEYLQSKNKYKAEILKKLEHQRLIEAERQRIAQMRQQQLESEQFLFF
EDQLKKQELARGQIRGQDSPVLSEQTDGSALSCFSTHQSNSLRNAFADHPHKSDGSNFAN
YSPPVNRALKPAATLSAVQNLVVEGLRCVVLSRDLCHKFLLLADSNTVRGIETCGILCGK
LTHNEFTITHVVVPKQSAGPDYCDVENVEELFNVQDQHGLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSTCKKKGFHPHTKDPKLFSIC
SHVLVKDIKTTVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccattcactgtgaattcactgaaaaagttagctgctatgcctgaccataca
gatgtttctctaagtccagaggagcgggtccgcgccctaagcaaacttggttgtaatatc
tccattaatgaagatatcaccccacgccgttacttcaggtccggagtggaaatggaaagg
atggcatctgtgtatttggaagaaggaaacctggaaaatgcctttgttctttataacaaa
tttataacgttatttgtagaaaaacttcccagccaccgagattaccagcagtgtgcagtt
ccagagaagcaggatattatgaagaaactgaaggagattgcgttcccaaggacagacgaa
ttgaaaacggacctgctaaggaaatataacatagaataccaagagtatttgcaaagtaaa
aacaaatataaagccgaaattctcaaaaagttggaacatcagagactgatagaggcagag
cgccagcggatagctcagatgcgccagcagcaactagagtctgaacagttcctgtttttt
gaagaccaactcaagaagcaggagttggctcgaggccagattcgaggtcaggactctccg
gtgttgtctgagcagactgacggaagtgcgctgtcctgcttttccacccaccagagcaac
tctctgaggaacgcatttgcagatcaccctcataaaagtgatggaagcaatttcgctaac
tactctcctcccgtgaacagggccctaaagccagcagccaccctgagtgctgttcagaat
ttggtggttgaagggctgaggtgtgtagttttatcaagagatctttgccataaatttctg
ctgctggctgactctaacacagtgagaggaatagagacctgtgggatcctctgtggaaaa
ctgacacacaatgaattcaccattactcatgtggttgtgccaaagcagtctgctggccca
gactattgcgatgtggagaacgtcgaagaattattcaatgttcaggatcaacatggtctc
ctcacactgggatggatccatacacaccccacgcaaacggcattcctgtccagtgtggat
ctccacactcactgctcctaccagcttatgttgccagaggccattgccattgtgtgttcc
ccaaagcataaagacaccggcattttcaggctcaccaacgctggcatgcttgaggtttct
acttgtaaaaagaagggcttccatcctcacaccaaggaccccaagctgttcagtatatgc
agccatgtgttagtaaaggacataaaaacaactgtgttggatctgaggtga

DBGET integrated database retrieval system