KEGG   Mus musculus (mouse): 76703Help
Entry
76703             CDS       T01002                                 

Gene name
Cpb1, 0910001A18Rik, 1810063F02Rik, 2210008M23Rik, AI504870
Definition
carboxypeptidase B1 (tissue) (EC:3.4.17.2)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    76703 (Cpb1)
   04974 Protein digestion and absorption
    76703 (Cpb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     76703 (Cpb1)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   76703 (Cpb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
3 A2; 3 6.29 cM
AA seq 415 aa AA seqDB search
MLLLLALVSVALAHASEENFDGNRVFRVSVHDEDDVSLIQELANTKQIDFWKPDSATQVK
PLTTVDFHVKAEDVVDVENFLEENEVLYEVLISNVKHILESQFDSHTRASGHSYTKYNNW
ETIEAWIQQVANDNPDLVSKRVIGTTFEGRNMYVLKIGKDRPNKPAFFIDCGFHAREWIS
PAFCQWFVREAVRTYKQEIHMKRLLDELDFYVLPVVNIDGYVYTWAKDRMWRKTRSTTAG
SSCFGVDPNRNFDAGWCEVGASRSPCSDTYCGPTPESEKETKALADFIRQNLSSIKAYLT
VHSYSQMMLYPYSYDYKLPENYEELNALVKGAAKELSTLHGTKYTYGPGATTIYPAAGGS
DDWAYDQGIKYSFTFELRDKGFFGFLLPESQIRQTCEETMLAVKYIANYVLEHPY
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctactggccctggtgagtgtggccctggctcatgcttctgaggagaacttt
gatggcaaccgggtgttccgtgtcagtgtacatgatgaagatgacgtcagcttaattcag
gaactagccaacaccaaacagattgatttctggaaaccagattctgctacacaagtgaaa
cctcttactacagttgactttcatgttaaagcagaagatgtcgttgatgtggagaacttt
ctcgaggagaatgaagttctctatgaggtattgataagcaacgtgaaacatattctggaa
tcccagtttgacagccacacccgtgcaagtggacacagctacaccaagtacaacaactgg
gaaacgatagaggcatggattcaacaagttgccaatgataatccagaccttgtttctaag
agagtcattggaaccacatttgaaggacgtaacatgtatgttctcaagattggcaaagat
agaccaaataagcctgccttcttcatcgactgtggtttccacgcaagagagtggatttct
cctgcattctgtcagtggtttgtgagagaggctgtccgtacctataaacaagagatccac
atgaaacgacttcttgacgaactggacttttatgttctgcctgtggtcaacattgacggc
tatgtctacacatgggctaaggaccgaatgtggagaaaaacccgctctactacggctgga
agttcctgctttggtgtagaccccaacagaaattttgatgctggctggtgtgaagtggga
gcttctcggagtccctgctctgacacttactgtggaccaactccagagtcagaaaaagag
acaaaggccctggcagatttcatccgccagaacctctcctccatcaaggcctatctgacc
gtccactcctactcacagatgatgctctatccttactcctacgactataagctgcccgag
aactatgaggagctgaatgccctggtgaaaggtgcagcaaaggagctttccactctgcat
ggcaccaagtacacatatggcccaggagctacaacgatctatcctgctgctgggggatct
gacgactgggcttatgatcagggaatcaaatattcctttacctttgaactccgggataaa
ggcttctttggctttctgcttcctgagtctcagatccgccaaacctgtgaggagacaatg
cttgcagtcaagtacattgccaattatgtcctagagcatccatattag

DBGET integrated database retrieval system