KEGG   Mus musculus (mouse): 76768Help
Entry
76768             CDS       T01002                                 

Gene name
Alpi, 2010001C14Rik, Akp6, gIAP
Definition
alkaline phosphatase, intestinal (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    76768 (Alpi)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     76768 (Alpi)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   76768 (Alpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 D; 1
AA seq 554 aa AA seqDB search
MQGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFL
GDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYL
CGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTY
AHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSD
SNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANR
NPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEK
ASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYE
LKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAH
VMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNAAGQATTTNNAAGQATVLLSLQLL
VSMLLLVGTAMVVS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagactgggtgctgctgttgtttttgggtctcaggatccatctgtcctttggt
atcatcccagctgaagaggagaacccggccttctggaacaagaaggcagctgaagccctg
gatgctgccaagaagctgcagcccattcagacatcagctaagaacctcatcatcttcctg
ggagacgggatgggggtacccacagtgacagccaccaggatcctaaaggggcagttggaa
ggccatctaggaccggagacacccctagccatggacctcttcccatacatggctctgtcc
aagacatacaacgtggacagacaggtcccagacagcgcaggcacagcaaccgcctatctc
tgtggggtcaaggccaactacaagaccatcggcctgagtgcagctgctcgattagaccag
tgcaacaccacatttggcaatgaggtcttctcagtgatgtaccgtgccaagaaagcaggg
aagtctgtgggagtggtgaccacgaccagggtgcagcatgcctctccagccggcacctac
gcacacacggtgaaccgtaattggtactcagatgcagagatgcctgcctctgcactgcag
gacggctgcaaggacatcgccactcaactcatctccaacatggacattgatgtgatcctc
ggtggaggccgaaagttcatgtttcccaaggggactccagaccctgagtacccaagtgac
agtaaccagtctggaaccaggctggatgatcagaacctggtgcaaacgtggctgtcaaag
catcagggagcccggtatgtttggaaccgatcagagctcattcaggcatcccaggaccca
gcagtaactcacctcatgggcctctttgagccaacagaaatgaaatatgatgccaaccga
aacccctcagtagacccttccctggcggagatgacagaggtggctgtgcgcatgctcagc
aggaatccacaaggcttctacctctttgtagaagggggtcgtattgaccaaggccaccat
gcgggcacagcttacctggcactgactgaggctgtcatgttcgactctgccatcgaaaag
gccagccagcttaccaatgagaaggacacgctaatactcatcactgctgaccactcccat
gtcttcgcatttggtggctacacacttagggggacctccatctttggtctggccccactc
aaagccctagatgacaaatcctacacctccattctctatggcaatggtccaggttatgag
ctgaaatcaggcaaccggcccaatgtcaccgaagctcagagtgttgatcccaactacaag
cagcaggcggctgtacccctgtcgtcagagacccacggcggggaggacgtggccatattt
gcgcgcggccctcaggcacacctggtgcacggagttcaggagcagaactacatcgcgcac
gtcatggcattcgcaggctgcttagagccctacaccgactgcggcctggcgccccctgcc
ggccagagccccgtcatcaccccgggccaggccaccaccacaaacaacgcggccggccag
gccaccaccacaaacaacgccgccggccaggccactgtcctgctgtccttgcaactgctg
gtcagcatgctgctgctagtagggacagccatggtggtgtcctga

DBGET integrated database retrieval system