KEGG   Mus musculus (mouse): 76800Help
Entry
76800             CDS       T01002                                 

Gene name
Usp42, 2410140K03Rik, 3110031A07Rik, A630018G05Rik, D5Ertd591e
Definition
ubiquitin specific peptidase 42 (EC:3.4.19.12)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     76800 (Usp42)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   76800 (Usp42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 82.5 cM
AA seq 1324 aa AA seqDB search
MTIVDKTEPSDPSTCQNQPGSCEAVSPEDMDTGSASWGAVSSISDVSSHTLPLGPVPGAV
VYSNSSVPEKSKPSPPKDQVLGDGIAPPQKVLFPSEKICLKWQQSHRVGAGLQNLGNTCF
ANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQTHITQALSNPGDVIKPMFVIN
EMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRSR
VKCLNCKGVSDTFDPYLDITLEIKAAQSVTKALEQFVKPEQLDGENSYKCSKCKKMVPAS
KRFTIHRSSNVLTISLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVLV
HTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRAVLNQQAYVLFYIRSHDVKNGGES
AHPAHSPGQSSPRPGVSQRVVNNKQVAPGFIGPQLPSHVMKNTPHLNGTTPVKDTPSSSV
SSPNGNTSVNRASPATASTSVQNWSVTRPSVIPDHPKKQKITISIHNKLPARQGQAPLNN
SLHGPCLEAPSKAAPSSTITNPSAIQSTSNVPTTSTSPSEACPKPMVNGKAKVGASVLVP
YGAESSEESDEESKGLAKENGVDMMAGTHSDRPEAAADDGAEASSHELQEPVLLNGANSA
DSDSQENSLAFDSASCQVQPELHTENLFSKLNGLPGKVTPAPLQSVPEDRILETFKLTNQ
AKGPAGEESWTTTGGSSPKDPVSQLEPISDEPSPLEIPEAVTNGSTQTPSTTSPLEPTIS
CTKEDSSVVVSAEPVEGLPSVPALCNSTGTILGDTPVPELCDPGDLTANPSQPTEAVKGD
TAEKAQDSAMAEVVERLSPAPSVLTGDGCEQKLLLYLSAEGSEETEDSSRSSAVSADTMP
PKPDRTTTSSCEGAAEQAAGDRGDGGHVGPKAQEPSPAKEKMSSLRKVDRGHYRSRRERS
SSGEHVRDSRPRPEDHHHKKRHCYSRERPKQDRHPTNSYCNGGQHLGHGDRASPERRSLS
RYSHHHSRIRSGLEQDWSRYHHLENEHAWVRERFYQDKLRWDKCRYYHDRYTPLYTARDA
REWRPLHGREHDRLVQSGRPYKDSYWGRKGWELQSRGKERPHFNSPREAPSLAVPLERHL
QEKAALSVQDSSHSLPERFHEHKSVKSRKRRYETLENNDGRLEKKVHKSLEKDTLEEPRV
KKHKKSKKKKKSKDKHRDRESRHQQESDFSGAYSDADLHRHRKKKKKKKRHSRKSEDFIK
DVEMRLPKLSSYEAGGHFRRTEGSFLLADGLPVEDSGPFREKTKHLRMESRPDRCRLSEY
GQGD
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaaactgaaccttcagacccatcaacctgtcagaaccagcctggc
agttgtgaggcggtctcacctgaagacatggacacaggctctgccagctggggcgctgtg
tcttcaataagtgatgtctcaagtcacacacttccattagggccagtgcctggtgctgta
gtttattctaactcgtctgtacctgaaaaatcaaagccatcaccaccaaaggatcaagtc
ctaggtgatggcattgctcctcctcaaaaggtcctgtttccatctgaaaagatttgtctt
aagtggcaacaaagtcatcgagttggcgctgggctccagaatttgggcaacacctgtttt
gccaatgccgcattgcagtgtctgacttacacgccacccctcgccaattacatgttatcc
catgaacactccaagacatgccacgcagaaggattttgtatgatgtgcacgatgcagaca
cacattacccaggcacttagcaaccctggggatgttatcaagccgatgttcgtcatcaat
gaaatgcggcgtatagctagacacttccgttttggaaaccaagaagatgcccatgaattt
cttcagtacacggtcgatgccatgcagaaagcatgtttaaatggcagcaataaattagac
agacacacccaggccaccaccctggtctgccagatatttggaggctacctaagatcccga
gttaaatgtttaaattgcaagggtgtttcagatacctttgatccatatctggacataacg
ttggagattaaggctgcacagagtgttaccaaggcgttagagcagtttgtgaagccagaa
caactggatggagaaaactcctacaagtgcagcaagtgcaaaaaaatggttccagcttca
aagagattcacaatccataggtcctctaatgttcttaccatctcactgaagcgctttgcc
aacttcaccggtggaaagattgctaaggatgtgaaatatcctgagtaccttgatatccgg
ccctatatgtctcagcccaatggagagccaattatttatgttttgtatgctgtgctggtg
cacactggttttaattgtcatgctggccactacttttgctacatcaaggctagcaatggc
ctctggtatcagatgaatgactccatcgtgtccaccagtgatatcagagcagtgcttaac
cagcaagcttacgtgctcttttatatcaggtcccatgatgtgaaaaatggaggggagtct
gctcatcctgcccatagccccggccaatcctctccccgcccaggagtcagtcagcgggta
gtcaacaacaagcaggtggctccagggtttattggaccccagctgccttcccatgtgatg
aagaacacgccacacttgaatggcaccacgccagtgaaagacacaccaagtagttctgtg
tcaagccctaacggaaacaccagcgtcaatagggccagtcctgctactgcttcgacttct
gtgcagaactggtctgttaccagaccctcagttattccagatcaccccaagaaacaaaaa
atcaccatcagtattcacaacaagttgcctgctcgccagggtcaggcaccactgaataac
agcctccatggcccttgtctggaggctcctagtaaggcggcaccctcctccaccatcact
aacccttctgcaatacagtctacctcgaacgtacccacaacgtcgacttcccccagtgag
gcctgtcccaagcccatggtgaacggcaaggctaaagtgggcgccagtgtgcttgtcccc
tatggggccgagtcctcagaagagtctgatgaggagtcgaagggcctggccaaggagaac
ggtgtggacatgatggccggcactcactccgataggccagaagctgctgcagatgacggt
gctgaggcttcctcccatgagcttcaagaacccgtcctgctaaatggtgctaatagcgca
gacagtgactcacaagagaacagcctggcatttgacagtgccagctgccaggtccagccc
gagctacacacagaaaacctcttttccaaacttaatggtcttcctggaaaggtgacgcct
gctcctttgcagtctgttcctgaagacagaatccttgagaccttcaagcttaccaaccag
gcaaagggtccagcgggtgaagagagttggactacgacagggggaagctctccaaaggac
cctgtttcacagctggagcccatcagtgatgagcccagtccccttgagataccggaggct
gtcaccaatgggagcacacagaccccttccaccacatcacccctggagcccaccatcagc
tgtaccaaagaagactcgtccgttgttgtctcagctgaacctgtggagggtttgccttcc
gtccctgctctttgtaacagcactggtactatcttgggggataccccagtgcccgaattg
tgtgaccctggagacttgactgccaacccgagccagccaaccgaagcagtgaaaggtgat
acagctgagaaggctcaggactctgccatggctgaagtggtggagaggctgagccctgct
ccctcagtactcacaggtgacgggtgtgagcagaaactcttactttacctcagcgcagag
gggtcagaggagacagaagactcttccagaagctcggcggtctctgctgacacgatgccc
cctaagcctgacaggaccaccaccagctcctgtgaaggggctgccgagcaggctgctggg
gacagaggcgatggaggccatgtgggacccaaagctcaggagccttccccagccaaggaa
aagatgagcagcctccggaaagtggaccgaggacactatcggagccggagagagcgctcc
tccagtggggagcacgtgagggacagcaggccccggccggaggaccatcaccataagaag
cggcactgctacagccgagagcggcccaagcaggaccgacaccctactaattcatactgc
aatgggggccagcacttgggccacggggacagagccagccctgagcgccgctccctgagc
aggtatagtcaccaccactcacggattaggagtggcctggagcaggactggagccggtac
caccatttggaaaatgagcatgcttgggtcagggagagattctaccaggacaagctgcgg
tgggacaagtgcaggtattaccacgacaggtacacgcccctatacacggcccgggacgcc
cgagaatggcggcctctgcatggtcgtgagcatgaccgccttgtccagtctggacggcca
tacaaggacagctactggggccgcaagggctgggagctgcaatcccgggggaaggaacgg
ccccacttcaacagcccccgagaggcccctagccttgctgtgcccctcgagagacatctc
caagagaaggctgcgctgagtgtgcaggacagcagccacagtctccctgagcgctttcat
gaacacaaaagtgtcaagtcgaggaagcggaggtatgagactctagaaaataatgatggc
cgtctagaaaagaaagtccacaaaagcctggagaaggacacgctagaggagccaagggtg
aagaagcacaaaaagtctaaaaagaaaaagaagtccaaagataaacaccgggatcgagaa
agcaggcaccagcaggagtctgatttttcaggagcatactctgatgctgacctccataga
caccggaagaaaaagaagaaaaagaaaaggcattccaggaagtcggaggactttataaag
gatgttgagatgcgtttaccgaagctctccagctacgaggccggcggccatttccggaga
acagagggcagctttctcctggctgatggtctgcctgtggaagacagcggccctttccgg
gagaaaacgaagcatttaaggatggaaagccggcctgacagatgccgtctgtcggagtat
ggccagggtgactaa

DBGET integrated database retrieval system