KEGG   Mus musculus (mouse): 76809Help
Entry
76809             CDS       T01002                                 

Gene name
Bri3bp, 2410150I18Rik, AI841257, AW742481
Definition
(RefSeq) Bri3 binding protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F
AA seq 253 aa AA seqDB search
MGARASQEPRTRVRAGLRVLLPVLLLALLLLALVAPGAQGARGRGAADKNSHRRATSSFS
QSVSSLFGEDNVRAAQKLLSRLTERFVQGVDMFLETLWKVWMELLEVLGLDVSNLSQYFS
PASVSNSPTRALVLVGVVLLAYWFLSLTLGFTFSLLHLVFGRFFWLVRVILFSMSCVYIL
HKYEGEPEHAVLPLCVVVAIYFMTGPMGYWRGSPGGLCSPSVEEKLEHLENQVRLLNIRL
NRVLENLDRSKDK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgcgcgcgtcccaggagccccggacccgggtccgggccgggttgcgggtgctg
ctgccggttctgcttctggcgctgctgctgctggcgctggtggctcctggagcgcagggg
gctcggggccgcggggctgcggacaagaacagccaccggcgcgcgacgagcagcttctcg
cagagcgtgagcagcctcttcggagaggacaacgtgcgcgcggctcagaagttactgtcc
aggctgaccgagcggttcgtgcagggagtggacatgttcttagagacgttatggaaagtt
tggatggagctcttagaagtccttgggcttgacgtgtccaacctgtcacagtacttcagc
ccagcctcagtgtccaacagccccacccgggccctggtgctggttggtgtggttctcctg
gcctactggttcttgtctctgaccttgggcttcaccttcagcctcctccacctggtgttt
ggccgcttcttctggctcgtgcgtgtcatcctgttctccatgtcctgcgtgtatatccta
cataagtacgagggcgagccagagcacgcagtgctaccgctctgcgtcgtggtggccatc
tacttcatgacggggcccatgggctactggcggggcagccccggtggcctttgcagcccc
agtgtggaggagaagctggaacacctggagaaccaggtgaggttgcttaacatccgcctc
aacagggtgctcgagaaccttgaccgctccaaggacaagtga

DBGET integrated database retrieval system