KEGG   Mus musculus (mouse): 77125Help
Entry
77125             CDS       T01002                                 

Gene name
Il33, 9230117N10Rik, Il-33, Il1f11, NF-HEV
Definition
(RefSeq) interleukin 33
  KO
K12967  
interleukin 33
Organism
mmu  Mus musculus (mouse)
Pathway
Cytosolic DNA-sensing pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    77125 (Il33)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    77125 (Il33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19; 19 C2
AA seq 266 aa AA seqDB search
MRPRMKYSNSKISPAKFSSTAGEALVPPCKIRRSQQKTKEFCHVYCMRLRSGLTIRKETS
YFRKEPTKRYSLKSGTKHEENFSAYPRDSRKRSLLGSIQAFAASVDTLSIQGTSLLTQSP
ASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLM
VNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIG
VKDNQLALVEEKDESCNNIMFKLSKI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagacctagaatgaagtattccaactccaagatttccccggcaaagttcagcagcacc
gcaggcgaagccctggtcccgccttgcaaaataagaagatcccaacagaagaccaaagaa
ttctgccatgtctactgcatgagactccgttctggcctcaccataagaaaggagactagt
tattttaggaaagaacccacgaaaagatattcactaaaatcgggtaccaagcatgaagag
aacttctctgcctatccacgggattctaggaagagatccttgcttggcagtatccaagca
tttgctgcgtctgttgacacattgagcatccaaggaacttcacttttaacacagtctcct
gcctccctgagtacatacaatgaccaatctgttagttttgttttggagaatggatgttat
gtgatcaatgttgacgactctggaaaagaccaagagcaagaccaggtgctactacgctac
tatgagtctccctgtcctgcaagtcaatcaggcgacggtgtggatgggaagaagctgatg
gtgaacatgagtcccatcaaagacacagacatctggctgcatgccaacgacaaggactac
tccgtggagcttcaaaggggtgacgtctcgcctccggaacaggccttcttcgtccttcac
aaaaagtcctcggactttgtttcatttgaatgcaagaatcttcctggcacttacatagga
gtaaaagataaccagctggctctagtggaggagaaagatgagagctgcaacaatattatg
tttaagctctcgaaaatctaa

DBGET integrated database retrieval system