KEGG   Mus musculus (mouse): 77254Help
Entry
77254             CDS       T01002                                 

Gene name
Yif1b, 9430029K10Rik, Yip1b
Definition
(RefSeq) Yip1 interacting factor homolog B (S. cerevisiae)
  KO
K20362  
protein transport protein YIF1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 B1
AA seq 311 aa AA seqDB search
MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGGLGY
PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKK
LGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSP
DLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLF
GKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTMAVAAAQPV
LMYWLTFHLVR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgacaggtttggcggcgccggcggggacgccccggctgcgtaagtggccctca
aagcggagggtcccagtgtcccaaccaggcatggctgatccccaccagttttttgatgac
acgagttctgccccaagccggggctatggaggccagccgtcacctggtggtctgggttac
cccccctcttcatccgacgcagccttcctggctgcccctatgtccaacatggcgatggtc
tacgggagcagcctggccgctcagggcaaggagctggtagataagaatatcgaccgcttc
atccccgtcagcaagctcaagtattactttgcagtggacacggtgtatgtgggcaagaag
cttgggctgctggtctttccctaccttcaccaggactgggaggtacagtaccaacaggac
accccagtggccccccgcttcgacatcaatgctccagacctctacattccagccatggct
ttcatcacctacatcttggtggccggccttgcactggggacccaggacaggttctcccca
gacctcctgggactgcaggcgagctcagctctggcctggctgactctggaagtcgtagca
atcctgctcagtctctacctggtcactgtcaacaccgacctcaccaccattgacctggtg
gccttcttgggctacaaatatgtggggatgattggcggcgtcctcacgggtctgctcttt
ggaaagatcggctactacctggtgcttgcctggtgctgtgtgtccatctttgtattcatg
atccggacactgcggctcaagatcctggcccaggcagcggccgaaggagtgccagtgcgt
ggggcgcggaaccagctgcgcatgtacctgactatggcagtggcagctgcgcagccggta
ctcatgtactggctcaccttccaccttgtacggtga

DBGET integrated database retrieval system