KEGG   Mus musculus (mouse): 77485Help
Entry
77485             CDS       T01002                                 

Gene name
Stk31, C330007K24Rik
Definition
(RefSeq) serine threonine kinase 31 (EC:2.7.11.1)
  KO
K16316  
serine/threonine-protein kinase 31 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     77485 (Stk31)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  Other families
   77485 (Stk31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 B2.3
AA seq 1018 aa AA seqDB search
MWGQRLFAGTAVAQSVSFPGLVQMDEDTHYNKVEDVVGSHVEDAVTFWAQNVSKNKDIMK
IGCSLSEVCPLANSVFGNLDPKKIYGGLFSEDKCWYRCKVLKTISDDKCLVRYIDYGNTE
ILNRSDIVEIPPELQFSSIAKKYRLWGLQIPSGQEVTQFDQGRTFLGSLIFEKEIKMRIK
ATYQDGTVIAQAEYGTVDIGEEVAKKGFAEKCRLTSGIDACEAKKPDPNQLALRSLKNPI
PLWGRRSNQSTFSRPKGHFNGRLTLDVKYETSAGNHVTFPKESLAAGDFNLGSNVSLAKI
KQDQKLIEENEKLKTEKEVLLENYKALELKVEQTAQELQQEKTATMDLTKHLESTLKTCV
GTRLKNLAAKVELLKEIRHINISIRFGNDLSDAMQVLDEGSFTTLASLNELEKIWAEYNV
AQEKIQTCLNENEGNILIAERNEVQQKLFVAVDVFILEVDDLPLDKRLKTLQDLATSLES
VYGKAKEGTNNSEETLRKFYDWQCTKREEFASIRSETEASLQHLVAWFQSSQKVFDLSLD
EPLTSEDLIGNIDEILEKTESCVCKELELSLIEQGVIDKEIILSTYSQVLQKIHSEEKFI
ATLLSKYKDSVEFKKQMIDCLNKNPNVDYLLSIKKTLKGLKAQLRWKLVEKSNLEESDDH
DGTEIEKIKQEITQLRNSVFQEIYHEREEYEKLNSLTQKWFPELPLLYPEIGLLKYMNSG
GLLTMSLERDLLDTEPMKELSSKRPLVCSEVNGQPVLLKGYSVDVDTEGRVIQRAASYHR
ACGYAKEESGLLPLIFLFLCKSDPVAYLMVPYYPKANLSAVQASMPLTSEEALKVMKGVA
RGLHTLHSANIIHGSLHQNNVFALNREQGIVGDYDFTKSESQRASVNAMVGGLSLLSPEL
KTGKPPSASSDLYAYGCLFLWLSVQNQEFETNEDGIPKVDQFHLDDNVKSLLCSLIYFRS
SMTAEQVLNAECFLLPKGKSVPIPEKEIECTQHSREDESKMESLDRYSEKTRNGEANP
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgtggggccagcggctctttgctgggacggctgtggcgcaaagtgtaagttttccagga
cttgtccaaatggatgaagatacacattacaataaagttgaagatgttgttggaagtcat
gtagaagatgcagtaacattttgggcccagaatgtcagtaaaaataaggatattatgaag
attggttgttcactctcagaagtttgtcctcttgctaattcagtttttggcaatcttgat
cctaagaagatttatggtggattgttttctgaagataagtgctggtacagatgcaaagtg
ctaaaaactatcagcgatgataagtgcctggtgaggtacattgactatggaaatactgaa
attctaaaccgatctgatatagtagaaattcctccggagctacaattttctagtattgcc
aagaagtatagactttggggactacagattccttctggccaagaagttacccagtttgat
cagggtagaacatttttggggagtttgatttttgaaaaagaaattaaaatgagaataaaa
gcaacatatcaagatggaacagttattgctcaggctgagtatggcactgtcgatataggg
gaagaagtggcaaagaaaggatttgcagaaaagtgcagactgacctcaggcattgatgcc
tgtgaggcaaagaaacctgatcctaatcagcttgctctcaggagtctcaagaaccctatc
cccctgtgggggcgcagatcaaaccagtcaaccttcagcaggccaaaggggcattttaac
gggaggctgactcttgatgtgaagtatgagaccagtgcaggcaatcacgtgacatttcca
aaggaaagtttggctgctggtgactttaatttagggtctaatgtcagcttggcaaaaatt
aaacaggaccagaaacttattgaagagaatgaaaagcttaaaacagagaaagaggttctt
ctagaaaattacaaagcattagaattaaaagttgagcagactgcccaggagctgcagcaa
gagaaaacagctaccatggatctgactaagcatttagaaagcactctgaagacgtgtgta
ggaaccaggctgaagaatttggcagctaaagtagaactattgaaagaaattaggcatatt
aacatcagtattcgctttggaaatgacctttcagatgctatgcaagtgttggatgaaggg
tcctttactactctagcatctttgaatgagttagagaaaatttgggctgaatataatgtt
gctcaggagaagatccaaacttgtcttaatgagaatgaaggtaatattttgattgctgaa
agaaatgaagtacaacagaagctgttcgtggctgtagatgtttttattctggaagtagat
gacttaccacttgataaacgcttaaaaacattgcaggacttagcaacttctttagaatca
gtgtatggaaaggccaaagaaggaactaataactctgaagaaacacttagaaagttttat
gactggcagtgtaccaaaagagaagagttcgccagtattaggagtgaaacagaggcatct
ctgcagcaccttgtggcatggttccagagcagccagaaggtttttgatctgtccttggat
gaaccattgacttcagaagacctgattggtaatattgatgaaattctagagaagactgag
tcatgtgtctgcaaagagctagagctgtctctcattgagcaaggtgtcatagacaaggag
attattttaagtacatacagtcaagtgctgcaaaagatccattctgaggaaaagttcatt
gccaccttgctgtccaagtataaggacagtgttgagtttaaaaagcagatgattgactgt
ttaaataagaaccccaatgtggattacttgctttctattaagaagacattgaaaggctta
aaagcacaactgagatggaaattggttgagaagagtaatttggaagaatctgatgaccat
gatggaactgaaattgagaaaataaagcaagaaataactcaattgcgaaatagtgttttc
caggaaatttatcatgagagggaggaatatgagaagctgaatagcttgacccagaaatgg
ttccctgagctgcctctgctgtatcctgaaataggattgcttaaatatatgaattctggt
ggtcttcttactatgagcttagagcgggaccttcttgacactgagcccatgaaggaactt
agcagcaagcgtcctctggtgtgctccgaggttaatgggcagccagttctcttaaagggc
tattccgtggatgttgacacagaaggcagggtgattcagagagcagcctcttaccataga
gcttgtggatatgctaaagaagagtctgggttactgccattaatattcttgtttttgtgt
aagtctgatcctgttgcctatctgatggtcccatattatcctaaggcaaacctgagtgca
gttcaagccagtatgcctttaacttcagaagaagctttaaaagtcatgaaaggtgttgcc
cgaggactgcatacattgcatagtgctaacataattcatggatcacttcatcagaacaat
gtatttgccttaaatcgtgaacaagggattgttggagattatgacttcaccaaatctgag
agccagcgagcttcagtcaacgcgatggttggtggattgagtttgctctcacctgaattg
aaaactggaaaacctccttctgcaagttcagacttatatgcttatggttgccttttctta
tggctttctgttcaaaatcaagagtttgagacaaatgaagatggaattccaaaagtagat
cagtttcatttggatgataatgtcaagtccctcctttgtagcttgatatattttagaagt
tcaatgactgctgagcaggttttgaatgctgaatgtttcttgcttccaaaggggaaatca
gttccaatcccagaaaaagagattgaatgtactcagcatagcagagaagatgaatcaaag
atggagagtctggatagatatagtgaaaagacaagaaatggtgaagccaacccttga

DBGET integrated database retrieval system