KEGG   Mus musculus (mouse): 77559Help
Entry
77559             CDS       T01002                                 

Gene name
Agl, 1110061O17Rik, 9430004C13Rik, 9630046L06Rik, AI850929, C77197
Definition
amylo-1,6-glucosidase, 4-alpha-glucanotransferase (EC:3.2.1.33)
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
mmu  Mus musculus (mouse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    77559 (Agl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     77559 (Agl)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     77559 (Agl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 G1; 3
AA seq 1532 aa AA seqDB search
MEHSKQIRILLLNEMEKLEKTLFRLEQGFELQFRLGPTLQGKAVTVYTNYPLPGEAFNRE
KFRSLDWENPTEREDDSDKYCKLHLQQSGSFQYYFLQGNEKSGGGYIVVDPILRIGVDNH
VLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLADQLE
LNPDFSRPSKRYTWSDVGQLVEKLKREWNILCITDVVYNHTATNSKWILEHPESAYNLVN
SPHLKPAWVLDRALWHFSCDVADGKYREKGVPALIENDQHMNCIRKIIWEDIFPRIQLWE
FFQVDVHKAVEQFRRLLSQENRRVTKSEPKEHLKIIQDPEYRRRGCAVDMDTALATFIPH
DNGPAAIEECCNWFRKRLEELNSEKHHLTSCHQEQAVNCLLGNVFYERLAGHGPKLGPVT
RKYPLVTRYFTFPFGEMALSAEEALIHLPDKACFLMAHNGWVMGDDPLRNFAEPGSDVYL
RRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATHFQGVRLDNCHSTPLHVAEYML
DAARKLQPNLYVVAELFTGSEELDNIFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGEP
VGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTVVSMACCASGSTRGY
DELVPHQISVVAEERFYTKWNPGASPADTGDVNVHSGIIAARCAINRLHQELGAKGFIQV
YVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEAR
TIERNTKPYKKDENSINGMPNMTVELREHIQLHESKIVRQAGVATKGPNEYIQEIEFENL
SPGSVIIFRVSLDPHAQVAVGILRNHLTQFSSHFKSGSLAVDNADPILKIPFASIASKLT
LAELNQVLYRCESEEQEDGGGCYDIPNWSSLKYAGLQGLMSVLAEIRPKNDLGHPFCENL
RSGDWMIDYVSGRLISRSGSIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGAYTTLLD
VAWKQMSSFVQNGSTFVKHLSLGSVQMCGVGKCPCLPLLSPSLLDVPCRLNEITKEKEQC
CASLAAGLPHFSSGLFRCWGRDTFIALRGMLLVTGRYLEARNIILAFASTLRHGLIPNLL
GEGTYARYNCRDAVWWWLQCIQDYCRTVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQPL
FEVIQEAMQRHMQGIQFRERNAGPQIDRNMKDEGFNITAGIDEETGFVYGGNRFNCGTWM
DKMGESDRARNRGIPATPRDGSAVEIVGLCKSAVRWLLELSKKNIFPYHEVRVKRHGKVV
AVSYDEWNRKIQNNFEKLFHVSEDPSDPNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPN
FTIAMVVAPELFTAEKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGVYDNALDNDNYNLA
RGFNYHQGPEWLWPIGYFLRAKLYFSKMMGPETAAKTVFLVKNVLSRHYVHLERSPWKGL
PELTNENGQYCPFSCETQAWSMAVVLETLYDL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atggaacacagtaagcagattcgaattttactactgaacgagatggagaagctagagaag
accctcttcagacttgaacaaggatttgaactacagttccgattaggcccaactttacaa
ggaaaagctgtcactgtatatacaaattacccattgcctggagaagcatttaatcgagaa
aagttccgttccttggattgggaaaacccaacggagagagaagacgattctgataaatac
tgtaaacttcatctgcagcagtctggatcttttcagtactacttccttcaaggaaatgag
aaaagtggaggaggttacatagtcgtggatcctattttacgcattggagttgataaccac
gtgttacccttggactgtgttactctgcagacgttcttagcaaagtgcttaggacccttc
gatgagtgggaaagccggctaagggtggcaaaggagtcaggttacaacatgattcacttc
accccactgcagactcttggactgtcccggtcatgctattcccttgccgatcagttagag
ctaaatcctgacttctcaaggcctagtaaaagatatacctggagtgacgttgggcagcta
gtggagaagctgaaaagggagtggaatattctttgtattaccgatgtggtctacaatcat
actgccactaatagtaagtggatccttgaacacccggaatctgcatacaatcttgtaaat
tctccacacttgaagcctgcctgggtcctagacagagcactctggcatttctcctgtgat
gttgcagatgggaagtacagagaaaaaggagtccctgctttgattgaaaatgaccaacac
atgaattgcattcgaaaaataatttgggaggacattttcccaaggattcaactctgggag
tttttccaagtagatgttcacaaagcagttgaacaatttagaagactgctctctcaagaa
aacagaagagtaactaagtctgaaccaaaagaacatcttaaaattattcaggaccctgaa
tacaggcggcgaggctgcgctgtagatatggacactgctctggcgacttttataccacat
gacaatgggccagctgcaattgaagagtgctgtaactggttccgtaagagactggaggag
ttaaactcagagaagcaccacctcaccagctgtcaccaggaacaggcagttaattgtctt
ttgggaaacgtgttttatgaacgactggcaggccatggccctaaactaggacctgtcacc
aggaagtatcctttagttaccaggtattttactttcccctttggagaaatggccttatcc
gcagaggaagccctgatccacctcccagataaagcgtgcttcctgatggcacacaacggg
tgggtgatgggcgatgacccgctccggaactttgccgagccaggttcggatgtttattta
aggagagaacttatttgctggggtgacagtgttaaattgcgctatgggaataaacccgag
gactgcccttatctgtgggcacacatgaagaaatacaccgagataactgccactcacttc
cagggagttcgtctggacaactgccactccacgcctctccacgtggctgagtacatgctg
gatgctgctaggaaattacagcccaatctttatgtagtggctgagctgttcacaggaagc
gaagagctggacaatatcttcgttactagactgggcatcagttccttaataagagaggca
atgagcgcgtataacagtcacgaagagggcagactggtctaccggtacggaggggaacct
gtcggctccttcgttcagccctgtttgaggccgctcatgcctgctatcgcgcatgccctg
tttatggacatcacccacgataatgagtgtccgattgtgcacagatcagcctatgatgct
cttccaagtaccacagttgtttccatggcatgctgtgccagtggaagcacaagaggctac
gacgagctagtgcctcatcagatttcagtggttgcagaggagcgattttacactaagtgg
aatcctggggcatcaccggcagatacaggggatgttaatgtccatagcgggattattgca
gccagatgtgccatcaataggctccatcaagagcttggagccaagggtttcattcaagtg
tatgtggatcaagtggatgaagacatagtggctgtaaccaggcactccccgagcatccac
cagtctgttgtggctgtatcgagaactgcttttaggaatcccaagacttccttttacagc
aaagaagtgcctcagatgtgcatccctggcaaaattgaagaggtagttctggaagctaga
actattgaaaggaacacaaaaccttataagaaagacgagaactcgatcaatggaatgccg
aacatgacagtggaacttagagaacacatccagcttcatgaaagtaaaattgtcagacaa
gctggagttgccacaaagggtcccaatgaatatattcaggaaatagaatttgagaaccta
tctccaggaagtgttattatattcagagttagtctcgatccacacgctcaagttgctgtg
gggattcttcggaaccacctgacccagttcagctctcactttaagtccggaagccttgct
gttgacaacgcagatcctatattaaaaatccccttcgcttccattgcctctaaattgact
ttggctgagctaaaccaggtactttaccgatgtgaatcagaagaacaagaagacggtggc
ggttgctatgacataccaaactggtcatcacttaagtacgcaggacttcaaggattaatg
tccgtgttggcagaaataagaccgaagaatgacctggggcatccattctgtgaaaacttg
aggtcgggagactggatgatcgactacgtgagtggtcggcttatttcaagatcaggaagt
attgctgaggttggtaaatggctgcaggctatgttcttctacctgaagcagatcccacgc
tacctcatcccctgctactttgacgctatattgattggtgcatacaccactctgctggat
gtagcgtggaaacagatgtcaagctttgttcagaacggatccaccttcgtgaagcacctg
tcactgggttctgtccagatgtgtggagtcgggaaatgcccttgtctgccgctgctttct
ccctcgctcctggatgtgccgtgcaggttaaatgagatcacaaaggagaaggagcagtgc
tgtgcctccttagctgcaggcttacctcacttttcttccggtctttttcgctgctggggg
agggacactttcattgcccttcgagggatgctgctggttactggacgctacctggaagcc
aggaacatcattttagcgtttgctagtaccctgcggcacggtctcatccctaacctcctc
ggcgaagggacatatgccaggtacaactgccgggacgccgtgtggtggtggctgcagtgc
attcaggactattgcaggacagttccaaacggcctggacatcctcaaatgcccggtgtcc
aggatgtatccaacagatgactccgcacccttgcctgctgggacactggaccagcctttg
tttgaagtcatccaggaagctatgcagaggcacatgcagggcatccagttccgagagagg
aacgccggtccacagatcgaccgaaacatgaaggacgagggtttcaacataactgcgggg
attgatgaagaaacaggatttgtttatggaggaaatcgcttcaactgtggcacgtggatg
gataaaatgggagagagtgaccgagctaggaacagagggatcccagccactccaagagat
gggtctgctgtggaaatcgtgggcttgtgtaaatctgctgttcgttggttgctggaattg
tctaagaaaaatatctttccttatcatgaagtcagagtaaaaagacatggaaaggttgtg
gcagtctcgtacgatgagtggaacagaaaaatacaaaacaatttcgaaaagctgtttcat
gtttccgaagacccttcagatcctaacgagaagcatccgaacctggttcacaaacgcggc
atctacaaggacagctatggtgcgtcgagtccttggtgtgactatcagctcaggcccaac
ttcaccatagcaatggtcgtggcccctgaactctttactgctgagaaggcttggaaggct
ttggaaattgcagaaaaaaaattgcttggtccccttggcatgaaaactttagacccagat
gacatggtttactgtggagtttatgataatgccttagacaatgacaactacaaccttgct
agaggcttcaattaccaccaaggacctgagtggctgtggccaattgggtattttcttcgt
gcaaagttgtatttttccaaaatgatgggtccagagactgctgcgaagactgtatttttg
gttaaaaatgttctttctagacattatgttcatcttgagagatccccatggaaaggcctt
ccggagctcaccaatgagaacggccagtactgccctttcagctgtgagacacaggcgtgg
tcaatggctgttgttctggaaaccctctatgatttatag

DBGET integrated database retrieval system