KEGG   Mus musculus (mouse): 77593Help
Entry
77593             CDS       T01002                                 

Gene name
Usp45, 3110003C05Rik, 4930550B20Rik, AI843191, Gcap7
Definition
ubiquitin specific petidase 45 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 A3; 4
AA seq 813 aa AA seqDB search
MRVKDPSKDLPEKGKRNKRPLLPHDEDSSDDIAVGLTCQHVSYAVSVNHVKKAVAESLWS
VCSECLKERRFCDGQPVLPADVWLCLKCGLQGCGKNSESQHSLRHFKSSGTESHCVVISL
STWVIWCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTGAFSRIIKLCEEKREAGEIKK
GKKGCTVPSVKGITNLGNTCFFNAVIQNLAQTYILFELMNEIKEDGTKFKISLSSAPQLE
PLVVELSSPGPLTSALFLFLHSMKEAEKGPLSPKVLFNQLCQKAPRFKGFQQQDSQELLH
HLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRIFIGELT
STVMCEECANISTMKDPFIDISLPIIEERVSKPVLLGKMSKCRSLQETDQDHNKGTVTVG
NAHQPRASRKHSSPNDKNQLSHDRKHLRKWPSEEEKTVVTHPKNDNLEASPPASTLSTEA
SLNESLTDGSERDASLESSVDADSEASEPEIASKQPVLLRSRGDSCGHAEQHPHLPLASE
LPQAKETHGGEEEMAEAIAELHLSGTVTGNRDFHREKQPLNVPNNLCFSEGKHTRLHSAQ
NAFQTLSQSYVTTSKECSVQSCLYQFTSMELLMGNNKLLCEDCTEKRRKCHKETSSAEKK
AGGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVNRHVDFPLTLDLAPFCAATCKN
ISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKVRVPSRKLSECITGRKTAAGLKEPDGELG
GHWVHVSDTYVQVVPESRALSAQAYLLFYERIL
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaaaagatccatcaaaagatctacctgaaaaaggcaaaagaaataaaagacca
ctgctgcctcatgatgaagattcttccgatgacattgctgtaggtctaacgtgccagcac
gtcagttatgctgtcagtgtgaatcatgtgaagaaagcagtagctgagagtctgtggtca
gtttgttcagaatgtttgaaagagagaagattctgcgatggacagccagtactgcctgct
gatgtttggttgtgcctcaagtgtggtttgcagggatgcggtaaaaactcagaaagccag
cattcactgagacacttcaagagctctgggacagagtcccattgtgttgtcatcagcctg
agtacatgggtcatatggtgttatgaatgcaatgaaaagttgtcgacacattgcaacaag
aaagttttggctcaaatagttgattttctccagaaacatgcttttaaaacacaaacaggt
gcattttctagaatcataaaactttgtgaagaaaaacgtgaagcaggtgaaataaagaag
gggaagaaaggctgcactgtgccatctgtcaaaggaattacaaacttagggaatacttgc
ttttttaatgcagtcattcagaacttggctcagacttacattctttttgaactgatgaac
gagataaaagaagatggcaccaaattcaagatttctctttcgtcagctccacagctggag
ccgttagtggtggaactctcgagcccaggaccactgacgtcagccttgttcctgtttctt
cacagcatgaaggaggctgaaaaaggaccactttctcctaaagttcttttcaatcagctt
tgtcagaaggctcctcggtttaaaggtttccagcaacaggacagccaggagcttctgcac
catctgttggatgcagtgaggacagaggagaccaagaggatacaagccagcattctaaaa
gccttcaacaacccaactaccaagactgctgatgatgaaactagaaaaaaggtcaaagcc
tatggaaaggaaggtgtgaagatgaacttcatagatcgcatctttattggcgaattaact
agcacagtcatgtgtgaagaatgtgcgaacatctctaccatgaaggatcccttcattgat
atctcacttcctatcatagaagaaagggtttcaaaacctgtacttttggggaaaatgagt
aaatgcagaagtttacaagaaacagaccaagatcataacaagggcaccgtgactgtagga
aatgcccatcaacccagagcttccaggaagcactcctcacctaacgacaagaaccaacta
agtcatgacagaaaacatttaagaaaatggccatctgaagaagagaaaactgttgttaca
cacccaaagaatgacaacttggaagccagcccgcctgccagcaccctcagcactgaggcg
tccctgaacgagagcctcactgacggcagcgagagggacgccagcctagagagcagcgtg
gatgccgacagcgaggcttcggagcccgagatcgcttccaagcagcctgtgctgctgcgg
tccaggggtgattcctgcggacacgcggagcagcacccacacctcccactggcaagtgaa
ttgccacaagccaaggagacgcatggtggcgaggaggaaatggcggaagcgattgctgaa
cttcatttgagtggcactgtaactggcaatagagatttccacagggaaaaacagccacta
aatgtcccaaataatttgtgtttttcagagggaaaacatacgaggcttcacagtgcccaa
aatgcttttcagaccctttctcagagttatgtaactacttctaaagaatgctcagtccag
tcctgtctctaccagttcacatccatggagttattaatgggcaacaataagctgctctgt
gaggactgtactgaaaagagacggaagtgccacaaagaaaccagctccgcagaaaagaaa
gcaggaggagtttataccaatgccaggaagcaactcctcatatctgccgttcctgctatc
ctaatccttcatcttaaaagattccaccaggctggcttgagtcttcgtaaagtaaacaga
catgtagactttccgcttacccttgacttggcaccgttctgtgcggctacctgtaagaat
ataagtgtgggggagaaggttctctacggtctctacggtatagtggagcacagcggctcc
atgagaggaggccactacactgcttacgtgaaagtgagagtaccctccaggaagctgtcc
gagtgcatcaccgggaggaagactgcagccggtttgaaagaacctgatggtgaattggga
ggccactgggtccatgtcagcgacacctatgtgcaggtggttccagagtcaagagccctg
agtgcacaagcttatcttcttttttatgaaagaatattataa

DBGET integrated database retrieval system