KEGG   Mus musculus (mouse): 77593Help
Entry
77593             CDS       T01002                                 

Gene name
Usp45, 3110003C05Rik, 4930550B20Rik, AI843191, Gcap7
Definition
ubiquitin specific petidase 45 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     77593 (Usp45)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   77593 (Usp45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 A3; 4
AA seq 765 aa AA seqDB search
MRVKDPSKDLPEKGKRNKRPLLPHDEDSSDDIAVGLTCQHVSYAVSVNHVKKAVAESLWS
VCSECLKERRFCDGQPVLPADVWLCLKCGLQGCGKNSESQHSLRHFKSSGTESHCVVISL
STWVIWCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTGAFSRIIKLCEEKREAGEIKK
GKKGCTVPSVKGITNLGNTCFFNAVIQNLAQTYILFELMNEIKEDGTKFKISLSSAPQLE
PLVVELSSPGPLTSALFLFLHSMKEAEKGPLSPKVLFNQLCQKAPRFKGFQQQDSQELLH
HLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRIFIGELT
STVMCEECANISTMKDPFIDISLPIIEERNQLSHDRKHLRKWPSEEEKTVVTHPKNDNLE
ASPPASTLSTEASLNESLTDGSERDASLESSVDADSEASEPEIASKQPVLLRSRGDSCGH
AEQHPHLPLASELPQAKETHGGEEEMAEAIAELHLSGTVTGNRDFHREKQPLNVPNNLCF
SEGKHTRLHSAQNAFQTLSQSYVTTSKECSVQSCLYQFTSMELLMGNNKLLCEDCTEKRR
KCHKETSSAEKKAGGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVNRHVDFPLTL
DLAPFCAATCKNISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKVRVPSRKLSECITGRKT
AAGLKEPDGELGGHWVHVSDTYVQVVPESRALSAQAYLLFYERIL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaaaagatccatcaaaagatctacctgaaaaaggcaaaagaaataaaagacca
ctgctgcctcatgatgaagattcttccgatgacattgctgtaggtctaacgtgccagcac
gtcagttatgctgtcagtgtgaatcatgtgaagaaagcagtagctgagagtctgtggtca
gtttgttcagaatgtttgaaagagagaagattctgcgatggacagccagtactgcctgct
gatgtttggttgtgcctcaagtgtggtttgcagggatgcggtaaaaactcagaaagccag
cattcactgagacacttcaagagctctgggacagagtcccattgtgttgtcatcagcctg
agtacatgggtcatatggtgttatgaatgcaatgaaaagttgtcgacacattgcaacaag
aaagttttggctcaaatagttgattttctccagaaacatgcttttaaaacacaaacaggt
gcattttctagaatcataaaactttgtgaagaaaaacgtgaagcaggtgaaataaagaag
gggaagaaaggctgcactgtgccatctgtcaaaggaattacaaacttagggaatacttgc
ttttttaatgcagtcattcagaacttggctcagacttacattctttttgaactgatgaac
gagataaaagaagatggcaccaaattcaagatttctctttcgtcagctccacagctggag
ccgttagtggtggaactctcgagcccaggaccactgacgtcagccttgttcctgtttctt
cacagcatgaaggaggctgaaaaaggaccactttctcctaaagttcttttcaatcagctt
tgtcagaaggctcctcggtttaaaggtttccagcaacaggacagccaggagcttctgcac
catctgttggatgcagtgaggacagaggagaccaagaggatacaagccagcattctaaaa
gccttcaacaacccaactaccaagactgctgatgatgaaactagaaaaaaggtcaaagcc
tatggaaaggaaggtgtgaagatgaacttcatagatcgcatctttattggcgaattaact
agcacagtcatgtgtgaagaatgtgcgaacatctctaccatgaaggatcccttcattgat
atctcacttcctatcatagaagaaaggaaccaactaagtcatgacagaaaacatttaaga
aaatggccatctgaagaagagaaaactgttgttacacacccaaagaatgacaacttggaa
gccagcccgcctgccagcaccctcagcactgaggcgtccctgaacgagagcctcactgac
ggcagcgagagggacgccagcctagagagcagcgtggatgccgacagcgaggcttcggag
cccgagatcgcttccaagcagcctgtgctgctgcggtccaggggtgattcctgcggacac
gcggagcagcacccacacctcccactggcaagtgaattgccacaagccaaggagacgcat
ggtggcgaggaggaaatggcggaagcgattgctgaacttcatttgagtggcactgtaact
ggcaatagagatttccacagggaaaaacagccactaaatgtcccaaataatttgtgtttt
tcagagggaaaacatacgaggcttcacagtgcccaaaatgcttttcagaccctttctcag
agttatgtaactacttctaaagaatgctcagtccagtcctgtctctaccagttcacatcc
atggagttattaatgggcaacaataagctgctctgtgaggactgtactgaaaagagacgg
aagtgccacaaagaaaccagctccgcagaaaagaaagcaggaggagtttataccaatgcc
aggaagcaactcctcatatctgccgttcctgctatcctaatccttcatcttaaaagattc
caccaggctggcttgagtcttcgtaaagtaaacagacatgtagactttccgcttaccctt
gacttggcaccgttctgtgcggctacctgtaagaatataagtgtgggggagaaggttctc
tacggtctctacggtatagtggagcacagcggctccatgagaggaggccactacactgct
tacgtgaaagtgagagtaccctccaggaagctgtccgagtgcatcaccgggaggaagact
gcagccggtttgaaagaacctgatggtgaattgggaggccactgggtccatgtcagcgac
acctatgtgcaggtggttccagagtcaagagccctgagtgcacaagcttatcttcttttt
tatgaaagaatattataa

DBGET integrated database retrieval system