KEGG   Mus musculus (mouse): 78303Help
Entry
78303             CDS       T01002                                 

Gene name
Hist3h2ba, 1500011O09Rik, AI413321
Definition
histone cluster 3, H2ba
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    78303 (Hist3h2ba)
  Immune diseases
   05322 Systemic lupus erythematosus
    78303 (Hist3h2ba)
  Substance dependence
   05034 Alcoholism
    78303 (Hist3h2ba)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   78303 (Hist3h2ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11; 11 B2
AA seq 126 aa AA seqDB search
MPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccttcccgctccactcccgccccgaagaaaggctccaagaaagccatcacc
aaggctcagaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcatccggacaccggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaatgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc
ctgctgctgcccggggagctggccaagcatgccgtgtccgagggcaccaaggcagtcacc
aaatacaccagctccaagtga

DBGET integrated database retrieval system