KEGG   Mus musculus (mouse): 78655Help
Entry
78655             CDS       T01002                                 

Gene name
Eif3j1, 1810016I04Rik, 2700079K05Rik, AA409117, AA409446, C78575, Eif3j, Eif3j-1, Eif3j-2, Eif3j2, Eif3s1, eIF-3-alpha-A, eIF-3-alpha-B, eIF3-alpha, eIF3-p35, eIF3j-A, eIF3j-B
Definition
eukaryotic translation initiation factor 3, subunit J1
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    78655 (Eif3j1)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    78655 (Eif3j1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
2 E5; 2
AA seq 261 aa AA seqDB search
MAAAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDD
ENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADK
LRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYA
SFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMK
DDLADYGGYEGGYVQDYEDFM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcagcggcggcgggggactcagactcttgggacgcggac
acgttctctatggaggacccggtgcggaaggtcgcgggcggcggcacggccggcggggac
cgctgggaaggcgaggacgaggacgaggacgtgaaggataactgggatgatgatgatgat
gaaaataaagaggaagcagaagtcaaaccagaagtaaaaatttcagagaagaaaaaaata
gcagaaaagataaaagagaaagaacggcagcagaagaaaaggcaagaagaaattaaaaag
aggttagaagaacctgaagaatctaaagtactaacacctgaagagcaattagcagataaa
ctccggctaaagaaattacaggaagagtcagaccttgaattagcaaaagaaacttttggt
gttaataataccgtttatggaatagatgctatgaacccatcttcaagagatgacttcaca
gagtttggaaagttactaaaagataaaattacacaatatgaaaaatcactatattatgcc
agttttttggaagccttagttcgggatgtctgtatttcattggaaattgatgacttgaaa
aagattaccaactcattgactgtgctctgcagtgaaaaacagaagcaagaaaagcaaagc
aaagccaaaaagaagaagaaaggcgtggttcctggagggggattaaaggccaccatgaaa
gacgacctggcagattatggtggatatgaaggaggctatgtacaagactatgaagacttc
atgtga

DBGET integrated database retrieval system