KEGG   Mus musculus (mouse): 78783Help
Entry
78783             CDS       T01002                                 

Gene name
Brpf1, 4833438B11Rik, 4930540D11Rik, Brpf2
Definition
(RefSeq) bromodomain and PHD finger containing, 1
  KO
K11348  
bromodomain and PHD finger-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    MOZ/MORF complex
     78783 (Brpf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 E3
AA seq 1212 aa AA seqDB search
MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDSPPPPQQTPLRK
HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS
EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHSAPASAAPKLPEVVY
RELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPIP
QEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAVH
QECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEVC
FANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLYM
KMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEEEDEEEDEGKSWSSE
KVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRLH
SYWTLKRQSRNGVPLLRRLQTHLQSQRNCEQVGRDSDDKNWALKEQLKSWQRLRHDLERA
RLLVELIRKREKLKRETIKIQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSE
VPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRL
REQGGAVLRQARRQAEKMGIDFETGMHIPHNLAGDEVSHHTEDVEEERLVLLENQKHLPV
EEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSGR
GNLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPKTA
GPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMGSLRQRKRGRSPRPSSSSDSDSDKST
EDPPMDLPANGFSSGNQPVKKSFLVYRNDCNLPRSSSDSESSSSSSSSAASDRTSTTPSK
QGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDEDSP
LDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEAREHL
YLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRSKV
QGEQSSETSDSD
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atgggggtggactttgacgtgaagaccttctgccacaatttgcgggcaactaagccacca
tatgagtgccctgtggagacttgccgcaaggtttacaagagttacagtggtatcgagtac
cacctgtaccactatgaccacgacagcccaccacccccacagcagaccccactgcgcaag
cacaaaaagaaagggcgccagtcacgaccagccaacaagcagtcacccagcccctctgaa
gtctcacagtcaccaggccgagaggtgatgagctatgctcaggcccagcgcatggtagaa
gtggaccttcatggccgtgtccaccgaatcagcatctttgacaacttggatgtggtgtca
gaggatgaggaggcccctgaggaggcccctgagaatggcagcaacaaggaaaacactgag
acacctgcggctacacctaagtcaggcaagcataagaacaaggagaaacgaaaagactct
aaccaccaccatcacagcgctcctgccagtgctgctcccaaattgcctgaggtggtgtat
cgtgagctagagcaagatacccctgacgcaccaccccggcccacttcctactaccggtac
atcgagaaatctgcagaggagctggatgaggaggtggagtatgacatggatgaagaggac
tatatctggctggatatcatgaatgagcggcggaagactgagggtgtaagtcccatccca
caagagatctttgagtacttaatggaccgtttggagaaggagtcgtactttgagagtcac
aataaaggtgaccccaatgcactagtggatgaagatgccgtgtgctgtatctgcaatgat
ggcgagtgccagaacagcaatgttatcctcttctgtgacatgtgtaacttggctgtgcac
caggagtgctacggtgtcccctatatccctgaaggccagtggctgtgccgccgttgcctg
cagtcaccttctcgtgcagtggattgtgctctgtgccccaataagggtggtgccttcaag
cagacagatgatggccgctgggcccacgtggtgtgtgccttgtggatccctgaggtttgc
tttgccaacacagtcttcctagaacctattgacagcattgagcacatcccaccagctcgg
tggaagctcacctgctacatttgtaaacagcggggctctggagcctgcatccagtgccat
aaggccaattgctacacagccttccatgtgacatgtgcccaacaagctggcctttacatg
aagatggaacctgtgcgggagacaggtgccaatggtacctcctttagcgtccgcaagaca
gcctactgtgacatccacacacccccaggttctgctcgtcgcctgcctgccctatcccac
agtgagggtgaggaagaagaggatgaagaagaagatgagggtaaaagctggagctcagag
aaggtcaagaaggccaaggccaagtctcggattaagatgaagaaagctcggaagatcttg
gcagagaagagggcagcagcacctgtggtgtccgtgccctgcatcccgccacacaggctc
agtaagatcaccaaccgcctgaccatccagaggaagagccagttcatgcagaggctgcac
agctactggactctgaaacgacaatcacggaatggggtcccactactcaggcgcctacaa
acacaccttcagtctcagaggaactgtgaacaagttgggagagattctgatgataaaaac
tgggccctcaaagaacagctcaagtcctggcagagactgcggcatgacctggagcgagct
cggctgctggtggagctgatccgcaagcgagagaaactaaaaagggagacgatcaagatc
cagcagattgccatggagatgcagctgacccctttcctcatcctcctccgaaaaaccttg
gagcagctccaagagaaggacacaggcaacatcttcagcgagccggtccctctgtctgag
gtacccgactacctagaccacatcaaaaagcccatggactttttcaccatgaagcagaac
ttggaggcttaccgctacttgaactttgatgattttgaggaggacttcaacctcattgtc
agcaactgcctaaagtataatgccaaggacaccatcttctacagggcagcagtgcgactc
cgtgagcagggtggtgctgtgctccgtcaagcccggcgacaggcagaaaaaatgggcatt
gactttgagacgggcatgcatatccctcacaacctggccggagatgaggtctcacaccac
actgaagatgtagaggaagaacggctggtcctgctggagaaccagaaacacctgccagta
gaagaacagctgaagttgttgctggagaggctggatgaagtcaatgccagcaagcagagt
gtgggccgctctcggcgtgcaaaaatgatcaagaaggagatgacagcattgcggcggaag
cttgctcaccagcgggagactggccgggatgggcctgagcgtcatggcccctcaggtcgg
ggcaatctgacaccccacccagcagcctgtgacaaagatggacagaccgacagtgctgca
gaagagagcagcagccaggaaacaagcaaaggcctgggtcccaacatgtcctcaaccccc
gcacatgaggtgggcaggagaacctcagttctgttctccaaaaagaacccgaagacagct
ggaccgcccaagaggccgggccggcccccaaaaaaccgggagagccagatgacccccagc
cacggaggcagtcctgtggggccccctcagctccccatcatgggctccctacgtcagcgc
aagcggggtaggagcccccggcccagttcaagctcagacagcgacagtgataagtccaca
gaagatcccccaatggacttaccagccaatggcttcagcagtgggaaccagccagtgaag
aagagtttcttggtgtaccgtaatgactgcaaccttccccgaagcagctcagactctgag
tccagcagcagcagcagcagcagtgcagcctcagaccggaccagcacaactccctcaaaa
caaggcaggggcaagccctctttctctcggggcacattcccagaagacagtagtgaagat
acctcaggcactgagaatgaggcctactccgtgggcactggccgcggcgtgggccacagc
atggtaagaaagagtctgggtcgaggagctggctggctgtcagaggatgaggactccccg
ttggatgctctggacctcgtgtgggccaaatgccgaggctatccatcatacccagctctg
atcattgatccaaagatgccccgagaaggtatgttccaccatggggttcctatccctgta
ccaccactggaggttctaaaacttggggaacaaatgacacaggaagcccgagagcatctc
tacctcgttctcttctttgacaacaaacgaacctggcagtggctgccccggactaagctt
gttcctctgggtgtgaaccaggatctagacaaagagaagatgctggagggccgcaagtcc
aacatccgcaagtcagtgcagattgcttaccacagggctctgcagcaccgaagcaaggtg
cagggtgagcagagcagcgagaccagcgatagtgactga

DBGET integrated database retrieval system