KEGG   Mus musculus (mouse): 78920Help
Entry
78920             CDS       T01002                                 

Gene name
Dlst, 1600017E01Rik, 4632413C10Rik, 4930529O08Rik, DLTS
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmu  Mus musculus (mouse)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    78920 (Dlst)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    78920 (Dlst)
  Amino acid metabolism
   00310 Lysine degradation
    78920 (Dlst)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     78920 (Dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 D3
AA seq 454 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCRGPGYPDNRKMVINSGSVFRVRF
FQTTAVCKNDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPA
NGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAETPAPAHKAEPAAPAAPPPPAAP
VLTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLK
EAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVN
AVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNEL
AIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVEVRPMMYVA
LTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcacgctgcgtgtcccgggcgttcagccgctcgctttctgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgtcggggacca
ggttaccctgacaacaggaagatggtcattaacagtggtagcgtcttcagggttcgcttc
ttccaaaccacggctgtgtgcaagaatgatgtgataacagtccaaaccccagcgtttgca
gagtctgtcacagagggagatgtcaggtgggagaaagctgttggagatgcggttgcagaa
gatgaagtggtgtgtgagattgagacagacaagacttctgtgcaggttccgtcgccagca
aatggcatcattgaagctcttttggtacccgatgggggcaaagttgaaggaggaactcct
ctgttcacactcaggaaaactggtgctgctcctgctaaggccaaaccagctgaaactcct
gctccagcccacaaagcagagcccgcagcaccggcggcccctcctccccccgcagcacct
gtgctcactcagatgccaccagtgccctcaccctcacagcctccttctagcaaaccagtg
tctgcaataaaacccactgctgcccctccactggctgaggcaggagctgctaaaggtctg
cgttcagaacatcgggagaaaatgaacaggatgcggcagcgcatcgcccagcgtctgaag
gaagcccagaacacgtgtgcaatgctgacgactttcaatgaggttgacatgagtaacata
caagagatgagagctcggcacaaggatgctttcctgaaaaaacataacctcaaattaggc
ttcatgtcagcatttgtgaaggcctcggcgttcgccttgcaggagcagcctgttgtaaat
gcagtgattgatgatgcaaccaaggaagtggtgtatagagattatattgacatcagtgtt
gcagttgctaccccgaggggtctcgtggttcctgtcatcaggaatgtggaaactatgaac
tatgcagatattgaacggaccattaatgaactaggagagaaggcccggaagaatgaactt
gccattgaagatatggatggtggtaccttcaccatcagcaacggaggagtttttggctca
ctttttggaacacccattatcaacccccctcaatctgccatcctgggcatgcacgccatc
tttgacaggcctgtggctgtgggaggcaaggtggaagttcgacctatgatgtatgtagcc
ctgacctatgaccaccggctgattgatggcagagaggctgtgactttcctccgaaaaatc
aaggcagcagtagaagatccaagagtcctcctcctagacctttag

DBGET integrated database retrieval system