KEGG   Mus musculus (mouse): 78925Help
Entry
78925             CDS       T01002                                 

Gene name
Srd5a1, 0610031P22Rik, 4930435F02Rik, S5AR_1, Srd5a-1
Definition
steroid 5 alpha-reductase 1 (EC:1.3.1.22)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    78925 (Srd5a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     78925 (Srd5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 C1; 13 35.55 cM
AA seq 255 aa AA seqDB search
MELDELRLLDALVYLEGFLAFVAFVGLQMVGSSYGRYSSQWSGRRVPARPAWFLQELPSM
AWPLYECIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLFTFVLAFLFC
TLNGYLQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYK
IPRGGLFEYVSSANYFGELVEWCGFALASWSLQGVVFALFTLCALFTRARQHHQWYLEKF
EDYPKTRKILIPFLL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggagttggatgagttgcgcctactggatgcgctagtctacctggagggtttcctggct
ttcgtggccttcgtggggctccagatggtgggctcttcctacggccgctactcctcgcag
tggtccggccgccgagtgcccgcgcgacctgcctggttcctacaggagctgccttcaatg
gcctggccgctgtacgagtgcatccgtcctgcagccgcccgactgggcaacctgcctaac
cgcgtcctgctagctatgtttctgatccactacgtgcaaaggacgctggtttttccagtt
ctgatcaggggagggaagcccaccctgctgttcacctttgtcttggccttcctgttctgc
accttaaatggctacttgcagagccgatacttgagccagtttgcggtgtatgctgaagac
tgggtaacccatccctgtttcctgacaggctttgccctgtggttagtgggcatggtgata
aatatccactcagaccacatcctgcggaatctgagaaaaccaggggaaactggatacaaa
atacccaggggaggcctgtttgaatatgtatcttcagccaactattttggggagctcgtg
gagtggtgtggctttgcactggccagctggtccctccagggcgtggtgtttgctctgttc
accctgtgtgcactgttcaccagagcgaggcagcatcatcagtggtacctcgagaagttt
gaagattaccccaaaacaagaaaaatactaattccattcctgctttag

DBGET integrated database retrieval system