KEGG   Mus musculus (mouse): 78928Help
Entry
78928             CDS       T01002                                 

Gene name
Pigt, 2510012P17Rik, 4930534E15Rik, CGI-06, NDAP, Ndap7
Definition
phosphatidylinositol glycan anchor biosynthesis, class T
Orthology
K05292  
phosphatidylinositol glycan, class T
Organism
mmu  Mus musculus (mouse)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    78928 (Pigt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H3; 2
AA seq 582 aa AA seqDB search
MAAAMPLGLPLRLLVLLLVGRGCCGCAEGPRDSLREELVITPLPSGDVAATFQFRTRWDS
DLQREGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWF
QDTVTDVDKSWRELSNVLSGIFCASLNFIDATNTVTPTASFKPLGLANDTDDYFLRYAVL
PREVVCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPICRNAHCTSISW
ELRQTLSVVFDAFITGQGKKDWSLFRMFSRTLTEACPLASQSLVYVDITGYSQDNETLEV
SPPPTSTYQDVILGTRKTYAVYDLFDTAMINNSRNLNIQLKWKRPPDNEALPVPFLHAQR
YVSGYGLQKGELSTLLYNSHPYRAFPVLLLDVVPWYLRLYVHTLTITSKGKENKPSYIHY
QPAQDRQQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVP
SVVAAKPVDWEGSPLFNTLFPVSDGSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVV
AVCYGSFYNLLTRTFHIEEPKSGGLAKRLANLIRRARGVPPL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccatgccgctcggtttgccgttgcggttactggtgctgttgctggtggga
cggggctgctgtggctgcgcggagggcccacgcgacagcctgcgagaagagctcgttatc
actccactgccttccggcgacgtggccgccacattccagttccgcacgcgttgggattcg
gatctgcagcgggaaggagtgtcccattacaggctcttccctaaagccctgggacagctg
atctccaagtactccctgcgggagctccacctgtcgttcacgcaaggcttttggaggacg
cgatactgggggccacccttcctgcaggctccgtcaggtgcagagctctgggtctggttc
caagacactgtcaccgatgtggataagtcctggagggagctcagcaatgtcctctcgggg
atcttctgtgcatccctcaacttcatcgacgccaccaataccgtcactcccaccgcctcc
ttcaaacctctgggactggccaatgacactgacgactacttcctgcgctacgctgtgctg
cctcgggaggttgtctgcactgagaacctcacgccatggaagaagctcttgccctgcagt
tccaaggccggtctctcagtgctattgaaagcagaccgcttgttccacaccagttaccac
tcccaggcagtgcacatccggcctatctgcagaaatgctcactgtaccagcatctcctgg
gagctgaggcagaccctttcggttgtctttgatgccttcatcacaggacaggggaagaaa
gactggtccctcttccgcatgttctcccggactctcacagaggcctgtccattggcgtct
cagagcctagtttatgtggacatcacaggctacagccaggataatgaaacactggaggtg
agccctcccccaacttccacataccaggatgtcattttgggcaccaggaagacctatgcc
gtctatgacttgtttgacacagccatgatcaataactctcgaaacctcaacatccagctc
aaatggaagagacccccagataatgaggccctacccgtgcccttcctgcatgcgcagcgg
tacgtgagtggctatggactgcagaagggagagctgagtactctgctgtacaactcccat
ccttatcgggccttccccgtgctgctgctggatgtcgtgccctggtacctgcggctgtat
gtgcacacgctcaccattacctccaagggcaaggagaataaaccaagttacatccactac
caacctgctcaggacaggcagcagccccacctcctggagatgctcattcagctgccagcc
aactccgtcaccaaggtctccatccagtttgaacgagccctgctcaagtggacagagtac
acaccagaccccaaccacggcttctatgtcagcccatctgtcctcagcgcccttgtgccc
agtgtggtggcagccaaaccagtggactgggaagggagccctctcttcaacaccttgttc
ccggtgtctgatggctccagctactttgtccgactctacacagagcccttgctagtgaac
ctgcccaccccggacttcagcatgccctacaatgtgatctgccttacgtgcacggtggtg
gccgtgtgctatggctccttctacaatctcctcacccgaacctttcacatcgaagagccc
aagtcgggcggcctggccaagcggctggctaacctcatccgccgtgcccgtggtgtgccc
cctctctag

DBGET integrated database retrieval system