KEGG   Mus musculus (mouse): 80283Help
Entry
80283             CDS       T01002                                 

Gene name
Abtb1, AI847549, BC003234, BPOZ, EF1ABP
Definition
(RefSeq) ankyrin repeat and BTB (POZ) domain containing 1
  KO
K10520  
ankyrin repeat and BTB/POZ domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     80283 (Abtb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 D1
AA seq 478 aa AA seqDB search
MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVRYLLANGA
RCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFV
VHGKPFRAHRCILGARSTYFANMLDTKWKGKSVVVLRHPLINPVAFGALLQYLYTGRLDI
GVEHVSDCERLAKQCQLWDLLDDLEAKCEKVSEFVASKPGTCVKVLTIEPPPADPRLRAD
MALLADCALPSELRGDLGELPFPCPDGFSSCPDICFRVADSSFLCYKAFFCGRSDYFRAL
LDDHFQESEEPAASGDPPVVTLHDISPDIFIHVLYYVYSDHTELPPELAYDVLSVADMYL
LPGLKRLCGRSLAQLLEEDSVVGVWRIAKMFRLARLEDQCTEYMAKVIEKLVEREDFVEA
VREEAAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLRALEDLLVSIGLDC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggataccagcgacttgtttgccagctgcaggaaaggggacgtgggccgtgtgcggtac
ctgctggagcagcgagacgtggaggtgaacgtgcgggataagtgggacagcacccctttg
tactatgcctgcctctgtgggcatgaggagttggtgcgctacctgttggctaatggagcc
cgctgtgaggccaacacctttgatggagagcggtgtctctacggagcgctaagcgaccct
attcgccgtgcactgagagactacaaacaggtcactgcgtcctgcaggaggcgggattac
tatgacgatttcctgcagcggcttctggaacagggcatccacagcgatgtggtctttgtg
gtacacggaaagccgttccgggcccatcgctgtatcctcggtgctcgcagtacctacttc
gccaacatgctggacaccaagtggaagggcaagagcgtcgtggttctcaggcaccccctg
atcaacccggtggcctttggggctctactgcagtacctgtatacaggccgcttggacatc
ggtgtagaacacgtgagtgactgtgagcgcctggccaagcagtgccagctgtgggacctg
ctggatgacctggaggctaagtgcgagaaggtgtctgaatttgtggcttccaagcctggc
acgtgtgtgaaggtgctgactattgaacctcctccagcagatccccggttacgggcagat
atggccctgctagctgactgtgccctgccatctgagctgcggggtgaccttggagagctg
cccttcccatgtcccgatggcttcagcagctgccccgatatctgcttccgagtggctgac
tccagcttcctctgctacaaggctttcttctgtggccgcagtgactacttccgggccctt
ctggatgaccactttcaagagagtgaggagcctgcagcctctggagatcccccagttgtc
accctgcatgacatctccccggacatcttcattcacgtgttgtactacgtatatagtgac
cataccgagctgcctcctgagttggcctacgatgttctgagtgtggctgacatgtacctt
ctgcctggcctgaagcggctgtgtggccgcagcctggcccagctgctggaggaggacagt
gtggtgggtgtttggcgcatagccaagatgttccggctggcccggctggaggaccagtgt
accgagtatatggccaaagtcatagagaagctggtagagcgggaggatttcgtggaggcc
gtgcgggaagaggcggcagctgtagcggcccggcaggagacagactccatcccgctcgtc
gatgacatccgcttccatgtggccagcacggtccagacatacagtgccattgaagaggca
cagcagcgactgcgggcactcgaggacctgctcgtgtccattggcttggactgctaa

DBGET integrated database retrieval system