KEGG   Mus musculus (mouse): 80898Help
Entry
80898             CDS       T01002                                 

Gene name
Erap1, Arts1, ERAAP, PILSA, PILSAP
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  
adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     80898 (Erap1)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M1
   80898 (Erap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13; 13 C1
AA seq 930 aa AA seqDB search
MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPEYMTPIHYDLMIHANL
STLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEMLSEEPLKVLEYPAHEQV
ALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEMRILAATQFEPTAARMAF
PCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIEDHFDITVKMSTYLVAFII
SDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFNIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIVSHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEVDALNSSHPVSTPVENPAQIRE
MFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYSYKNTKNEDLWNSMMHICPTDGT
QTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQKGFPLITITVSGRNVHMKQEHYMK
GSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEAVQWIKFNVGMNGYYIVH
YADDGWASLSGLLKEAHTTISSNDRASLINNAFQLVSIEKLSIEKALDLTLYLKNETEIM
PIFQALNELIPMYKLMEKRDMIEVETQFKDFLLKLLKDLIDKQTWTDEGSVSERMLRSQL
LLLACVRNYQPCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQS
SLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWK
FLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQT
IETIEENIRWMDKNFDKIRLWLQKEKPELL
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgccctctcttcttcccctagtattgacatttttatctgtgtcatctccttcttggtgt
cagaacagtgatatagaatctctaaaagctagtaatggagactcattcccttggaataat
atgcgacttcctgagtatatgaccccgattcattatgatctcatgatccatgcaaacctc
agcactctgactttctggggaaaaacagaagtagaaatcatagctagccggcccaccagc
accattattatgcatagtcaccacctgcaaatatctaaggccaccctcagaagaggagct
ggagagatgctgtctgaagaaccactgaaggtcctggaatatcctgctcatgagcaagtt
gcactgctggctgcccagccgcttcttgctgggtccctgtacacagttatcatcgactat
gctgccaacctgtctgagagtttccatggattctataagagcacctacagaacacaggaa
ggtgaaatgagaatacttgcagcaacacagtttgaacccacagctgctagaatggctttt
ccctgctttgatgaacctgccctcaaggcaagtttttccatcaagataaagagggatcca
aggcacctggccatctccaacatgcccctggtgaaatctgtgaatgttgctgaaggactc
atagaagaccattttgacatcactgtgaagatgagtacctacctagtggccttcatcatt
tctgattttaagtctgtgagcaagatgactaagagtggagtcaaggtttctgtgtatgct
gtgccagacaagataaatcaagccgattatgctctggatgctgcagtgactcttctagag
ttttatgaggattatttcaacattccatatcctttacccaagcaagatcttgctgcaatc
ccagactttcagtctggtgctatggaaaactggggactgaccacatacagagagtcctct
ctgttatacgataaagaaaagtcttctgcatctagtaagcttggcatcacaatgattgtg
tcccatgaactggctcaccagtggttcgggaacctggtcaccatggaatggtggaatgac
ctttggctcaatgaaggatttgccaaatttatggagtttgtgtctgtcactgtgacccat
cctgaactaaaagttgaagactatttctttggcaagtgttttaatgcaatggaagttgat
gcattaaactcctctcaccctgtatccacacctgtggagaatcctgcgcagattcgggag
atgtttgatgatgtttcttatgaaaagggagcttgtattctgaatatgctaagagattat
ctgagtgcagatacatttaaaagaggaattgtacagtatctccaaaagtatagttataaa
aacacaaaaaacgaggacctgtggaatagcatgatgcatatttgccctacagatggcaca
caaacaatggatggcttctgctctagaagccaacactcatcatcaacctcacactggcgt
caggaggttgtagatgtaaagaccatgatgaacacatggacactgcagaagggctttcct
ctgataaccatcactgtgagtgggcggaatgtgcacatgaagcaagaacactacatgaag
ggttcagaacgcttcccagagactgggtatttgtggcatgttccactgacattcattacc
agcaaatcagactcagtccagagatttttgctgaagacaaagacagatgtgctcatcctc
ccagaagcagtgcagtggatcaaatttaacgtgggaatgaatggctattacattgtgcat
tacgcggatgatggatgggcttctctgagtggccttttaaaagaagcgcacacaacaatc
agcagtaatgatcgggcaagtctcatcaacaatgcatttcagctggtcagcattgaaaag
ttatcaatagaaaaagccctggatttaaccctgtacttgaaaaatgaaactgaaattatg
cccatattccaagctttgaatgaactcatacctatgtataagttaatggagaaaagagat
atgattgaggtggaaactcaatttaaggacttccttctcaagttgctgaaggaccttatt
gataagcagacttggacagatgaaggctctgtctcagagaggatgctcaggagccagctc
ctcctcctcgcatgtgtgcgcaattatcagccctgtgtgcagagggcagagcgctatttc
agagagtggaagtcatctaatggaaacatgagcatccctattgatgtgaccttggctgtg
tttgctgtcggggcccaaaacacagaaggctgggattttctttatagtaaatatcagtct
tctttgtctagtactgagaaaagccaaattgaattttccctctgtacaagcaaagatcca
gaaaaacttcagtggcttctagatcaaagttttaagggagagataataaaaactcaggaa
tttccacatattctcacactcattggcagaaacccagtgggttatccattggcctggaag
tttctgagggaaaattggaataagcttgtacagaaatttgaacttggctcatcgtccata
gctcacatggtaatgggaacaacagaccagttttccaccagagcacgtcttgaagaggta
aaaggattcttcagttccttgaaagaaaacggttctcagctccgttgtgttcaacaaacc
attgagaccattgaagaaaacatacgatggatggataagaattttgataaaataagactg
tggctgcaaaaagaaaagccagagttgctgtga

DBGET integrated database retrieval system