KEGG   Mus musculus (mouse): 80902Help
Entry
80902             CDS       T01002                                 

Gene name
Zfp202, C130037E22Rik, Znf202
Definition
(RefSeq) zinc finger protein 202
  KO
K09229  
KRAB and SCAN domains-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    80902 (Zfp202)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 B
AA seq 641 aa AA seqDB search
MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFRRFRYQEASSP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVQGQEVLSEETLHLGLEPESSSEQQDPTQTLTTEQPHEEALR
SPDLGTQEQETLQHDEEHLPLPECEVPVSQDVDLPTEQGSGHPEMVALLTALSQGLVTFK
DVALCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDDTSQIREEEPQVPGV
HESQEPAEPEILSFTYTGDMSEAEEESVEQQDTHKSTLANTEVHQSPDWEIVIEDNTSRL
NERFGTNVSKVNSFTNIRETMPVHSQSGRQHHCPLCAKSFTCNSHLIRHLRTHTGEKPYK
CMECGKSYTRSSHLARHQKVHKMNTPHKHPPNRKTVDGPLVQSEVTTRVEKPYTCDDCGK
HFRWTSDLVRHQRTHTGEKPFFCTICSKSFSQKSVLTTHQRIHVGGKPYVCANCGENFSE
QKQYLTHRKTHVSEEHHLCNECGRSFSHSAAFAKHLKGHASVRNCRCDECGKTFSRRDHL
VRHQRTHTGEKPFTCATCGKSFSRGYHLIRHQRVHTGKTKT
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagccttggagccagaggaccaagatctttgggaagaagaaggagttctgatg
gtgaaactggaggatgatttcacgtgcgggccagaatccgccttggagggcgatgatcct
gtactggagacctctcaccagaacttccgacgctttcgataccaggaagcatcaagccct
cgagaagctctcatcagacttcgagagctttgtcatcagtggctgaggccagagaggaga
actaaggagcagattcttgagctgctcgtgttggagcagttcctcactgtcctgcctgga
gaactgcagagctgggtgcgaggccagcggcccgagagtggcgaggaggcagtgacgctg
gtggagggtttgcagaaacaacccaggagaccaaggcggtgggtaaccgtccatgttcag
ggccaggaagtcctgtcagaggagaccctacacctagggctggagccggagtcctccagt
gagcaacaagatccaacacagaccttgaccactgagcagccccatgaggaagccctccga
agcccagatctggggacacaggaacaggagaccttgcagcatgacgaggagcacctgccc
ctgccggaatgtgaggttccagtgtcccaggatgtagaccttcccacagaacaagggtct
ggacacccagagatggttgctcttctcactgctctctctcagggactggtcacattcaag
gatgtggctctgtgcttctcacaggatcagtggagtgatctggatccaacacaaaaagaa
ttctatggagagtatgtcttggaagaagactgtggaattgtggtctctctgtcatttcca
attcccagactagatgatacctcccagattagagaagaagagcctcaggtcccaggtgtc
catgagtctcaagagcctgcagaaccagaaatcctgagttttacctatacaggagacatg
agtgaagctgaggaagaaagtgttgagcaacaagatacacacaagtctactttggcaaac
acagaagttcaccagtctccagattgggaaatagtcattgaggataataccagtagactt
aatgaaagatttggtacaaacgtttctaaagttaatagtttcacaaatattagggaaact
atgcctgttcactcccaatcagggaggcagcatcattgccctctatgtgcaaaaagcttc
acgtgtaattctcatcttattaggcacttaagaactcacacaggagaaaaaccctataaa
tgtatggagtgtgggaaaagttacacacggagctcacatctagctaggcaccagaaagtc
cataagatgaacactcctcataaacatcctccaaaccggaagactgtggatggccctctg
gtccagtctgaggtaactacccgtgtggagaaaccatatacctgtgatgattgtggaaaa
catttccgttggacgtcggacctggtcaggcaccagaggacacatacaggagaaaaacct
tttttctgtactatctgtagcaaaagcttcagccagaaatctgtgttaacgacacaccaa
agaatccatgttggaggcaagccctacgtgtgtgcgaactgtggcgagaacttcagtgag
cagaagcagtatctgacacaccgcaagacacacgtgtctgaggagcaccatctgtgcaat
gagtgtggccgctccttcagccatagtgcagcatttgccaagcacctgaaaggccatgct
tcagtgaggaactgccgctgcgatgagtgtggtaaaacctttagcaggagggatcacctt
gtcagacatcaacgaacacacactggggaaaagccttttacctgtgccacctgtgggaaa
agcttcagcagaggctatcacttaatccggcatcagagagtccacacaggaaagaccaag
acctag

DBGET integrated database retrieval system