KEGG   Mus musculus (mouse): 81601Help
Entry
81601             CDS       T01002                                 

Gene name
Kat5, AI839539, CPLA2, Htatip, Htatip1, PLIP, Tip55, Tip60
Definition
(RefSeq) K(lysine) acetyltransferase 5 (EC:2.3.1.48)
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    81601 (Kat5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     81601 (Kat5)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    81601 (Kat5)
   HAT complexes
    TIP60 complex
     81601 (Kat5)
    NuA4 complex
     81601 (Kat5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 A
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctgcccgtgctgcggcgcaaccag
gacaacgaagatgagtggcccctggctgagatcctgagcgtgaaggacatcagtggccga
aagcttttctatgtccattacattgacttcaacaaacgtctggatgaatgggtgactcac
gagcggctggacttaaagaagatccaatttcccaagaaagaggccaagacacctaccaag
aacggacttcctgggtcccgccccggctctcccgaaagagaggtgccggcctccgcccag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccatcccaggtggcgagcctgaccagccgctctcctccagctcctgcctg
caacccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaaccccagtg
cccagcgagacagccccagcctcggttttccctcagaatgggtcagcccgtagggcagtg
gcagcccagcctggacggaagcggaaatctaattgcttgggcactgatgaggattctcag
gacagctcagatggaataccgtcagcaccacgaatgactggcagtctggtgtctgaccgg
agccacgacgacattgtcacccggatgaagaacattgagtgtattgagcttggccggcac
cgcctcaagccgtggtacttctccccgtacccacaagagcttaccacgctacccgtcctc
tacctgtgcgaattttgcctcaaatatggccgtagcctcaagtgtctgcaacgccacttg
accaaatgtgatcttcggcaccctccaggcaatgaaatttaccgcaagggcaccatctcc
ttttttgagattgatggacggaaaaacaagagttactcacaaaacctgtgtcttctggcc
aagtgtttcctggaccacaaaacactgtactatgacactgaccccttcctcttctacgta
atgacggagtatgactgcaaaggtttccacatcgtgggctacttctccaaggaaaaggaa
tccacagaagattacaatgtggcctgcatcttgactctgcctccctaccagcgccggggc
tatggcaagctgcttattgagttcagctatgaactctcgaaagtagaagggaagaccgga
actcctgagaaacccctgtcagatcttggcctcctatcctaccgaagttactggtcccaa
accatcttggagatcctgatggggctgaagtcggagagcggggagaggccacagatcacc
atcaatgagatcagtgaaatcactagtatcaagaaagaagatgtcatctccacactgcag
tatctcaacctcatcaattactacaagggccagtatatcctaactctgtcagaagacatc
gtggatgggcatgagcgggctatgctcaagcggctccttcggattgactccaagtgtctg
cacttcactcccaaagactggagcaagagaggaaagtggtga

DBGET integrated database retrieval system