KEGG   Mus musculus (mouse): 81601Help
Entry
81601             CDS       T01002                                 

Gene name
Kat5, AI839539, CPLA2, Htatip, Htatip1, PLIP, Tip55, Tip60
Definition
K(lysine) acetyltransferase 5 (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
HTLV-I infection
Class
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19
AA seq 461 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQ
NGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNI
ECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNE
IYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIV
GYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLL
SYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQY
ILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctgcccgtgctgcggcgcaaccag
gacaacgaagatgagtggcccctggctgagatcctgagcgtgaaggacatcagtggccga
aagcttttctatgtccattacattgacttcaacaaacgtctggatgaatgggtgactcac
gagcggctggacttaaagaagatccaatttcccaagaaagaggccaagacacctaccaag
aacggacttcctgggtcccgccccggctctcccgaaagagaggtgaaacggaaggtggag
gtggtttcaccagcaaccccagtgcccagcgagacagccccagcctcggttttccctcag
aatgggtcagcccgtagggcagtggcagcccagcctggacggaagcggaaatctaattgc
ttgggcactgatgaggattctcaggacagctcagatggaataccgtcagcaccacgaatg
actggcagtctggtgtctgaccggagccacgacgacattgtcacccggatgaagaacatt
gagtgtattgagcttggccggcaccgcctcaagccgtggtacttctccccgtacccacaa
gagcttaccacgctacccgtcctctacctgtgcgaattttgcctcaaatatggccgtagc
ctcaagtgtctgcaacgccacttgaccaaatgtgatcttcggcaccctccaggcaatgaa
atttaccgcaagggcaccatctccttttttgagattgatggacggaaaaacaagagttac
tcacaaaacctgtgtcttctggccaagtgtttcctggaccacaaaacactgtactatgac
actgaccccttcctcttctacgtaatgacggagtatgactgcaaaggtttccacatcgtg
ggctacttctccaaggaaaaggaatccacagaagattacaatgtggcctgcatcttgact
ctgcctccctaccagcgccggggctatggcaagctgcttattgagttcagctatgaactc
tcgaaagtagaagggaagaccggaactcctgagaaacccctgtcagatcttggcctccta
tcctaccgaagttactggtcccaaaccatcttggagatcctgatggggctgaagtcggag
agcggggagaggccacagatcaccatcaatgagatcagtgaaatcactagtatcaagaaa
gaagatgtcatctccacactgcagtatctcaacctcatcaattactacaagggccagtat
atcctaactctgtcagaagacatcgtggatgggcatgagcgggctatgctcaagcggctc
cttcggattgactccaagtgtctgcacttcactcccaaagactggagcaagagaggaaag
tggtga

DBGET integrated database retrieval system