KEGG   Mus musculus (mouse): 81897Help
Entry
81897             CDS       T01002                                 

Gene name
Tlr9
Definition
(RefSeq) toll-like receptor 9
  KO
K10161  
toll-like receptor 9
Organism
mmu  Mus musculus (mouse)
Pathway
Toll-like receptor signaling pathway
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Tuberculosis
Measles
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    81897 (Tlr9)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    81897 (Tlr9)
   05162 Measles
    81897 (Tlr9)
   05168 Herpes simplex infection
    81897 (Tlr9)
   05144 Malaria
    81897 (Tlr9)
   05142 Chagas disease (American trypanosomiasis)
    81897 (Tlr9)
   05143 African trypanosomiasis
    81897 (Tlr9)
Cellular antigens [BR:mmu04090]
 Proteins
  81897 (Tlr9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9; 9 F1
AA seq 1032 aa AA seqDB search
MVLRRRTLHPLSLLVQAAVLAETLALGTLPAFLPCELKPHGLVDCNWLFLKSVPRFSAAA
SCSNITRLSLISNRIHHLHNSDFVHLSNLRQLNLKWNCPPTGLSPLHFSCHMTIEPRTFL
AMRTLEELNLSYNGITTVPRLPSSLVNLSLSHTNILVLDANSLAGLYSLRVLFMDGNCYY
KNPCTGAVKVTPGALLGLSNLTHLSLKYNNLTKVPRQLPPSLEYLLVSYNLIVKLGPEDL
ANLTSLRVLDVGGNCRRCDHAPNPCIECGQKSLHLHPETFHHLSHLEGLVLKDSSLHTLN
SSWFQGLVNLSVLDLSENFLYESITHTNAFQNLTRLRKLNLSFNYRKKVSFARLHLASSF
KNLVSLQELNMNGIFFRLLNKYTLRWLADLPKLHTLHLQMNFINQAQLSIFGTFRALRFV
DLSDNRISGPSTLSEATPEEADDAEQEELLSADPHPAPLSTPASKNFMDRCKNFKFTMDL
SRNNLVTIKPEMFVNLSRLQCLSLSHNSIAQAVNGSQFLPLTNLQVLDLSHNKLDLYHWK
SFSELPQLQALDLSYNSQPFSMKGIGHNFSFVTHLSMLQSLSLAHNDIHTRVSSHLNSNS
VRFLDFSGNGMGRMWDEGGLYLHFFQGLSGLLKLDLSQNNLHILRPQNLDNLPKSLKLLS
LRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKALTNGTLPNGTLLQKLDVSSNSIVSVVPA
FFALAVELKEVNLSHNILKTVDRSWFGPIVMNLTVLDVRSNPLHCACGAAFVDLLLEVQT
KVPGLANGVKCGSPGQLQGRSIFAQDLRLCLDEVLSWDCFGLSLLAVAVGMVVPILHHLC
GWDVWYCFHLCLAWLPLLARSRRSAQTLPYDAFVVFDKAQSAVADWVYNELRVRLEERRG
RRALRLCLEDRDWLPGQTLFENLWASIYGSRKTLFVLAHTDRVSGLLRTSFLLAQQRLLE
DRKDVVVLVILRPDAHRSRYVRLRQRLCRQSVLFWPQQPNGQGGFWAQLSTALTRDNRHF
YNQNFCRGPTAE
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggttctccgtcgaaggactctgcaccccttgtccctcctggtacaggctgcagtgctg
gctgagactctggccctgggtaccctgcctgccttcctaccctgtgagctgaagcctcat
ggcctggtggactgcaattggctgttcctgaagtctgtaccccgtttctctgcggcagca
tcctgctccaacatcacccgcctctccttgatctccaaccgtatccaccacctgcacaac
tctgacttcgtccacctgtccaacctgcggcagctgaacctcaagtggaactgtccaccc
actggccttagccccctgcacttctcttgccacatgaccattgagcccagaaccttcctg
gctatgcgtacactggaggagctgaacttgagctataatggtatcaccactgtgccccga
ctgcccagctccctggtgaatctgagcctgagccacaccaacatcctggttctagatgct
aacagcctcgccggcctatacagcctgcgcgttctcttcatggacgggaactgctactac
aagaacccctgcacaggagcggtgaaggtgaccccaggcgccctcctgggcctgagcaat
ctcacccatctgtctctgaagtataacaacctcacaaaggtgccccgccaactgcccccc
agcctggagtacctcctggtgtcctataacctcattgtcaagctggggcctgaagacctg
gccaatctgacctcccttcgagtacttgatgtgggtgggaattgccgtcgctgtgaccat
gcccccaatccctgtatagaatgtggccaaaagtccctccacctgcaccctgagaccttc
catcacctgagccatctggaaggcctggtgctgaaggacagctctctccatacactgaac
tcttcctggttccaaggtctggtcaacctctcggtgctggacctaagcgagaactttctc
tatgaaagcatcacccacaccaatgcctttcagaacctaacccgcctgcgcaagctcaac
ctgtccttcaattaccgcaagaaggtatcctttgcccgcctccacctggcaagttccttt
aagaacctggtgtcactgcaggagctgaacatgaacggcatcttcttccgcttgctcaac
aagtacacgctcagatggctggccgatctgcccaaactccacactctgcatcttcaaatg
aacttcatcaaccaggcacagctcagcatctttggtaccttccgagcccttcgctttgtg
gacttgtcagacaatcgcatcagtgggccttcaacgctgtcagaagccacccctgaagag
gcagatgatgcagagcaggaggagctgttgtctgcggatcctcacccagctccgctgagc
acccctgcttctaagaacttcatggacaggtgtaagaacttcaagttcaccatggacctg
tctcggaacaacctggtgactatcaagccagagatgtttgtcaatctctcacgcctccag
tgtcttagcctgagccacaactccattgcacaggctgtcaatggctctcagttcctgccg
ctgactaatctgcaggtgctggacctgtcccataacaaactggacttgtaccactggaaa
tcgttcagtgagctaccacagttgcaggccctggacctgagctacaacagccagcccttt
agcatgaagggtataggccacaatttcagttttgtgacccatctgtccatgctacagagc
cttagcctggcacacaatgacattcatacccgtgtgtcctcacatctcaacagcaactca
gtgaggtttcttgacttcagcggcaacggtatgggccgcatgtgggatgaggggggcctt
tatctccatttcttccaaggcctgagtggcctgctgaagctggacctgtctcaaaataac
ctgcatatcctccggccccagaaccttgacaacctccccaagagcctgaagctgctgagc
ctccgagacaactacctatctttctttaactggaccagtctgtccttcctacccaacctg
gaagtcctagacctggcaggcaaccagctaaaggccctgaccaatggcaccctgcctaat
ggcaccctcctccagaaactcgatgtcagtagcaacagtatcgtctctgtggtcccagcc
ttcttcgctctggcggtcgagctgaaagaggtcaacctcagccacaacattctcaagacg
gtggatcgctcctggtttgggcccattgtgatgaacctgacagttctagacgtgagaagc
aaccctctgcactgtgcctgtggggcagccttcgtagacttactgttggaggtgcagacc
aaggtgcctggcctggctaatggtgtgaagtgtggcagccccggccagctgcagggccgt
agcatcttcgcgcaggacctgcggctgtgcctggatgaggtcctctcttgggactgcttt
ggcctttcactcttggctgtggccgtgggcatggtggtgcctatactgcaccatctctgc
ggctgggacgtctggtactgttttcatctgtgcctggcatggctacctttgctagcccgc
agccgacgcagcgcccaaactctcccttatgatgccttcgtggtgttcgataaggcacag
agcgcagttgccgactgggtgtataacgagctgcgggtgcggctggaggagcggcgcggc
cgccgagccctacgcttgtgtctggaggaccgagattggctgcctggccagacgctcttc
gagaacctctgggcttccatctatgggagccgcaagactctatttgtgctggcccacacg
gaccgcgtcagtggcctcctgcgcaccagcttcctgctggctcagcagcgcctgttggaa
gaccgcaaggacgtggtggtgttggtgatcctgcgtccggatgcccaccgctcccgctat
gtgcgactgcgccagcgtctctgccgccagagtgtgctcttctggccccagcagcccaac
gggcaggggggcttctgggcccagctgagtacagccctgactagggacaaccgccacttc
tataaccagaacttctgccggggacctacagcagaatag

DBGET integrated database retrieval system