KEGG   Mus musculus (mouse): 81905Help
Entry
81905             CDS       T01002                                 

Gene name
Cacng8
Definition
calcium channel, voltage-dependent, gamma subunit 8
Orthology
K04873  
voltage-dependent calcium channel gamma-8
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:mmu04921]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:mmu04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:mmu04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:mmu05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:mmu05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:mmu05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 A1; 7 1.98 cM
AA seq 423 aa AA seqDB search
MESLKRWNEERGLWCEKGVQVLLTTIGAFSAFGLMTIAISTDYWLYTRALICNTTNLTAG
DDGPPHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYL
LRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYI
SANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSD
LLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRGSSEASPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLASAGGGGSGAGVGAYGGAAGAAGGGGAGSERDRGSSAG
FLTLHNAFPKEAASGVTVTVTGPPAAPAPAPAPPAPAAPAPGTLSKEAAASNTNTLNRKT
TPV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ctggagtcattgaaacgctggaatgaagagaggggtttgtggtgtgaaaagggcgttcag
gtactactgaccaccatcggcgccttctcggcttttggcctcatgaccatcgccatcagc
actgactactggctctacacaagagctctcatctgcaacaccaccaacctcacagcaggt
gatgacggaccaccccatcgtgggggcagtggctcctccgagaagaaggaccctgggggc
ctcacacattcaggcctctggcggatatgctgcctggaagggttgaaaagaggtgtctgc
gtgaagatcaaccacttcccggaggacacggactacgaccacgacagcgcggagtacctg
ctccgagtagtccgggcttccagcatctttcctatcctgagcgccatcctgctgctgctc
gggggcgtgtgcgtagctgcctcccgcgtctacaagtccaaaaggaacatcatcctgggc
gcagggatcctgttcgtggcagcaggcttgagcaacatcatcggggtgattgtgtacata
tcggccaacgccggcgagcctggccccaagagggacgaggagaagaaaaaccactactcg
tacggctggtccttctacttcggcgggctgtccttcatcctggctgaggtgatcggagta
ctggccgtcaacatctacatcgagcgcagccgcgaggcacactgccaatcacgctcggac
ctgctcaaggccggcggcggcgcgggcggcagtggcgggagcggcccctcggccatcctc
cgtctgcccagttaccgcttccgctaccgccgccgctcccgctccagctcccgaggctcc
agcgaggcgtcgccatcccgggatgcgtctcccggcggccccgggggcccgggcttcgcc
tccacggacatctccatgtacacgctcagccgcgacccgtccaagggcagcgtggctgcg
gggctggcgagcgccggtggcggcggcagcggtgccggcgtgggtgcctacggcggggcg
gccggggcggcggggggcggcggggcgggctcggagcgggaccgcgggagctcggcgggt
tttctcacgctgcacaacgccttccccaaggaagcggcgtccggcgtcacggtcacagtc
accggaccgcccgctgcacccgcgcccgcgcccgcgccgcccgctcctgcagcgcccgcg
cccgggaccctgtccaaagaggccgcggcgtccaacaccaacacgctcaacaggaaaacc
acgcccgtgtag

DBGET integrated database retrieval system