KEGG   Mus musculus (mouse): 81905Help
Entry
81905             CDS       T01002                                 

Gene name
Cacng8
Definition
calcium channel, voltage-dependent, gamma subunit 8
Orthology
K04873  
voltage-dependent calcium channel gamma-8
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    81905 (Cacng8)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    81905 (Cacng8)
  Circulatory system
   04260 Cardiac muscle contraction
    81905 (Cacng8)
   04261 Adrenergic signaling in cardiomyocytes
    81905 (Cacng8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    81905 (Cacng8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    81905 (Cacng8)
   05414 Dilated cardiomyopathy (DCM)
    81905 (Cacng8)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   81905 (Cacng8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 A1; 7 1.98 cM
AA seq 423 aa AA seqDB search
MESLKRWNEERGLWCEKGVQVLLTTIGAFSAFGLMTIAISTDYWLYTRALICNTTNLTAG
DDGPPHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYL
LRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYI
SANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSD
LLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRGSSEASPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLASAGGGGSGAGVGAYGGAAGAAGGGGAGSERDRGSSAG
FLTLHNAFPKEAASGVTVTVTGPPAAPAPAPAPPAPAAPAPGTLSKEAAASNTNTLNRKT
TPV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ctggagtcattgaaacgctggaatgaagagaggggtttgtggtgtgaaaagggcgttcag
gtactactgaccaccatcggcgccttctcggcttttggcctcatgaccatcgccatcagc
actgactactggctctacacaagagctctcatctgcaacaccaccaacctcacagcaggt
gatgacggaccaccccatcgtgggggcagtggctcctccgagaagaaggaccctgggggc
ctcacacattcaggcctctggcggatatgctgcctggaagggttgaaaagaggtgtctgc
gtgaagatcaaccacttcccggaggacacggactacgaccacgacagcgcggagtacctg
ctccgagtagtccgggcttccagcatctttcctatcctgagcgccatcctgctgctgctc
gggggcgtgtgcgtagctgcctcccgcgtctacaagtccaaaaggaacatcatcctgggc
gcagggatcctgttcgtggcagcaggcttgagcaacatcatcggggtgattgtgtacata
tcggccaacgccggcgagcctggccccaagagggacgaggagaagaaaaaccactactcg
tacggctggtccttctacttcggcgggctgtccttcatcctggctgaggtgatcggagta
ctggccgtcaacatctacatcgagcgcagccgcgaggcacactgccaatcacgctcggac
ctgctcaaggccggcggcggcgcgggcggcagtggcgggagcggcccctcggccatcctc
cgtctgcccagttaccgcttccgctaccgccgccgctcccgctccagctcccgaggctcc
agcgaggcgtcgccatcccgggatgcgtctcccggcggccccgggggcccgggcttcgcc
tccacggacatctccatgtacacgctcagccgcgacccgtccaagggcagcgtggctgcg
gggctggcgagcgccggtggcggcggcagcggtgccggcgtgggtgcctacggcggggcg
gccggggcggcggggggcggcggggcgggctcggagcgggaccgcgggagctcggcgggt
tttctcacgctgcacaacgccttccccaaggaagcggcgtccggcgtcacggtcacagtc
accggaccgcccgctgcacccgcgcccgcgcccgcgccgcccgctcctgcagcgcccgcg
cccgggaccctgtccaaagaggccgcggcgtccaacaccaacacgctcaacaggaaaacc
acgcccgtgtag

DBGET integrated database retrieval system