KEGG   Mus musculus (mouse): 81906Help
Entry
81906             CDS       T01002                                 

Gene name
Cyp4x1, A230025G20, CYPIVX1, CYP_a, Cyp4a28-ps
Definition
cytochrome P450, family 4, subfamily x, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Serotonergic synapse
Class
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mmu04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
4 D1; 4
AA seq 507 aa AA seqDB search
MEASWLETRWARPLHLALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKF
LQEDNMETLDEIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKMQYLHQLLTPC
IGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEV
FEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKL
SPKGHCFQELGKVIHQYTEKIIQDRKKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFS
DADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLD
EMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWND
PKVFDPLRFTKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAPDLT
RPPAFSSHTVLRPKHGIYLHLKKLLEC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctcctggctggagactcgttgggcgcggcccttgcacctggctttggtgttc
tgcctggcgctggtgctgatgcaggccatgaagctctacctgcggagacagcgactgctg
cgcgacctgagccccttcccggggcctcccgcccactggctcctgggacaccagaagttt
cttcaggaggataatatggagacgcttgatgagattgtcaaaaagcacccttgtgccttc
ccctgctgggtagggcccttccaggcatttttctacatctatgacccagactatgcgaag
atatttctgagcagaacagacccaaagatgcagtatctgcaccagctcctgactccatgc
attggacgaggactcctgaatttagatgggcccaggtggttccaacaccgctgcctccta
actcctgcattccatcaggacatcctaaaaccatgtgtggacacgatggcccactctgtg
aaagtgatgctggataaatgggagaagatgtggaccactcaggaaacaaccatcgaggtt
tttgaacacatcaacttgatgaccctggacataataatgaaatgtgcttttggccaggag
accaactgccagataaacggcacctatgagtcttacgtgaaggcaacatttgaacttggt
gaaatcatatcttctcgcttgtacaatttctggcatcatcatgacataattttcaaactc
agtcctaagggccactgcttccaggagttaggcaaagtgatacatcaatacacagaaaag
ataatccaggacagaaagaaaatcctcaagaatcaagtaaagcaggatgacactcagacg
tctcaaatttttctggatattgttctttctgcacaggctgaagatgaacgagccttctca
gatgctgaccttcgggctgaggtgaacaccttcatgtgggcaggacatgatgcctctgca
gctagcatctcctggctcctttactgcctggctctaaatcccgagcatcaggacagatgc
cggacagagatcaggagcatcctgggagatgggtcttccatcacctgggaacagctggat
gagatgtcatacaccacaatgtgcatcaaggagacactccgcttgattcctcctgtccca
tccatctccagggagctcagcaaaccccttaccctcccagatggacactcactgcctgca
ggtatgactgtggttcttagtatttggggtctccaccacaaccctgctgtctggaacgac
ccaaaggtctttgaccccttgagattcactaaggagaattctgatcagagacacccctgt
gccttcctaccattctccagtggtccaaggaactgcatcgggcagcagtttgccatgctg
gagctaaaggtggccattgccttgattctgctccactttcaagtagctccagacctcacc
aggcctcctgccttctccagccacactgtcctcagacccaagcatggaatctatttgcac
ctgaagaaactccttgagtgttag

DBGET integrated database retrieval system