KEGG   Mus musculus (mouse): 81906Help
Entry
81906             CDS       T01002                                 

Gene name
Cyp4x1, A230025G20, CYPIVX1, CYP_a, Cyp4a28-ps
Definition
cytochrome P450, family 4, subfamily x, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    81906 (Cyp4x1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     81906 (Cyp4x1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   81906 (Cyp4x1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
4 D1; 4
AA seq 507 aa AA seqDB search
MEASWLETRWARPLHLALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKF
LQEDNMETLDEIVKKHPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKMQYLHQLLTPC
IGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEV
FEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKL
SPKGHCFQELGKVIHQYTEKIIQDRKKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFS
DADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLD
EMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWND
PKVFDPLRFTKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAPDLT
RPPAFSSHTVLRPKHGIYLHLKKLLEC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctcctggctggagactcgttgggcgcggcccttgcacctggctttggtgttc
tgcctggcgctggtgctgatgcaggccatgaagctctacctgcggagacagcgactgctg
cgcgacctgagccccttcccggggcctcccgcccactggctcctgggacaccagaagttt
cttcaggaggataatatggagacgcttgatgagattgtcaaaaagcacccttgtgccttc
ccctgctgggtagggcccttccaggcatttttctacatctatgacccagactatgcgaag
atatttctgagcagaacagacccaaagatgcagtatctgcaccagctcctgactccatgc
attggacgaggactcctgaatttagatgggcccaggtggttccaacaccgctgcctccta
actcctgcattccatcaggacatcctaaaaccatgtgtggacacgatggcccactctgtg
aaagtgatgctggataaatgggagaagatgtggaccactcaggaaacaaccatcgaggtt
tttgaacacatcaacttgatgaccctggacataataatgaaatgtgcttttggccaggag
accaactgccagataaacggcacctatgagtcttacgtgaaggcaacatttgaacttggt
gaaatcatatcttctcgcttgtacaatttctggcatcatcatgacataattttcaaactc
agtcctaagggccactgcttccaggagttaggcaaagtgatacatcaatacacagaaaag
ataatccaggacagaaagaaaatcctcaagaatcaagtaaagcaggatgacactcagacg
tctcaaatttttctggatattgttctttctgcacaggctgaagatgaacgagccttctca
gatgctgaccttcgggctgaggtgaacaccttcatgtgggcaggacatgatgcctctgca
gctagcatctcctggctcctttactgcctggctctaaatcccgagcatcaggacagatgc
cggacagagatcaggagcatcctgggagatgggtcttccatcacctgggaacagctggat
gagatgtcatacaccacaatgtgcatcaaggagacactccgcttgattcctcctgtccca
tccatctccagggagctcagcaaaccccttaccctcccagatggacactcactgcctgca
ggtatgactgtggttcttagtatttggggtctccaccacaaccctgctgtctggaacgac
ccaaaggtctttgaccccttgagattcactaaggagaattctgatcagagacacccctgt
gccttcctaccattctccagtggtccaaggaactgcatcgggcagcagtttgccatgctg
gagctaaaggtggccattgccttgattctgctccactttcaagtagctccagacctcacc
aggcctcctgccttctccagccacactgtcctcagacccaagcatggaatctatttgcac
ctgaagaaactccttgagtgttag

DBGET integrated database retrieval system