KEGG   Mus musculus (mouse): 83428Help
Entry
83428             CDS       T01002                                 

Gene name
Ucn3
Definition
urocortin 3
Orthology
K05257  
urocortin 2/3
Organism
mmu  Mus musculus (mouse)
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mmu04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13 A1; 13
AA seq 164 aa AA seqDB search
MLMPTYFLLPLLLLLGGPRTSLSHKFYNTGPVFSCLNTALSEVKKNKLEDVPLLSKKSFG
HLPTQDPSGEEDDNQTHLQIKRTFSGAAGGNGAGSTRYRYQSQAQHKGKLYPDKPKSDRG
TKFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKKK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgcccacctacttcctgctgccacttctgctgctcctaggaggtccaaggaca
agcctctcccacaagttctacaacactggaccagtcttcagctgcctcaacacagcccta
tctgaggtcaagaagaacaagctggaagatgtgcccttgctgagcaagaagagctttggc
cacctgcccacacaagacccctcaggggaagaagatgacaaccaaacgcacctccagatc
aaaagaactttctcaggtgccgcgggtgggaatggagctgggagcacccggtacagatac
caatcccaggcacagcacaaggggaagctgtacccagacaagcccaaaagcgaccggggc
accaagttcaccctttcccttgatgttcccactaacatcatgaacatcctcttcaacatc
gacaaggccaagaatttgcgagccaaggcagctgccaatgctcagctcatggcacagatt
gggaagaagaagtaa

DBGET integrated database retrieval system