KEGG   Mus musculus (mouse): 83563Help
Entry
83563             CDS       T01002                                 

Gene name
Usp26
Definition
ubiquitin specific peptidase 26 (EC:3.4.19.12)
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A5; X
AA seq 835 aa AA seqDB search
MEPILINAQVQMWSAKAGMSKSRNALIETCVGKREVKLILYFSTGKIKTLQLHDNIKSVV
LQTYGEDQNYLHLTFKNNDFLFVEKLTTTDARRLKRFLDKTSQGSIRPARSDERCGEPST
SAQELNGSGSSCETNSECFESPKESEMCMFRELSLLPSSSTFLHNVGLLENQFIKRKRFF
SDLAKNEKQSNLKDSIRDFEANLVVCISNEKGKERNVREVDISKPGFGFPFETNYPEDSG
VDVRDLNDLITKLFSPVLLETHCIENGLEWHEYMKTYLLYPEKLWQGLPNVGNTCYINVV
LQSLCSIPLFINDLFNQGFPWIKAPKDDFNMLLMQLLVLKDIYNARFRQKLLIGITKALP
IFGEIFAVDRQNDAHEFLSLCLVQLKETFQRVTMMWQSENDSGDFYLLKDIFADYATINK
MPVCPVTNNFEFELLSSIFCKACGLTLFKGEPSRYLSINIPQGGKDMSIQSTLDLFFSAE
ELEHRCEKCLYNKSVSFHRFGRLPRVIIVHLKRYHFNESWVMKKDERPILVSKYLRLSCH
CSKSTKPPPPLRPGEHVKNLDLLKPLEVLGSEILKLPFNSVRTSRSKGFETINITSNRES
EAQSGKRVSEVLSGKVQQENSGKGDTAHIVGSELTKETEKLKKHEEEHRPSDLDSGSIRE
AQKYQQAEKCNEGRSDKQISLEALTQSRPKPISQEQTENLGKTTLSHTQDSSQSSQSSSD
SSKSSRCSDDLDKKAKPTRKVDPTKLNKKEDNVYRLVNIINHIGNSPNGGHYINDAFDFK
RQSWFTYSDLHVTRTQEDFVYRGRSSTGYVFFYMHNDIFEELLAKETQSTSTSKG
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggagcccatattgataaatgctcaagtccagatgtggagtgcaaaggcaggaatgtcc
aagtcaagaaatgcactcattgaaacatgtgtaggaaaacgagaagttaaacttattctc
tatttcagcactggaaagattaagactttgcaactacacgataatattaaaagtgtggtc
cttcaaacctatggcgaagaccagaattacctacatttgacttttaaaaataatgatttc
ttgtttgttgagaaactcaccaccacagatgccagaagactgaagagatttctagacaaa
acctctcaaggtagtattcggccagccagaagtgatgagagatgtggtgagcctagcaca
agtgcacaggagttgaatggctctggaagttcatgtgaaacaaatagtgagtgctttgaa
tcacccaaagaaagtgaaatgtgcatgtttcgtgagttgtctttgcttccatcctcatca
acctttcttcacaatgtaggattattagaaaaccaattcataaagaggaaaagatttttc
tctgatttagcaaaaaatgaaaaacagagcaacctgaaggacagtatcagggactttgag
gcaaatttagtggtgtgtatctctaatgaaaagggaaaagaaaggaatgtaagagaagta
gacatcagtaagccagggtttggatttccatttgagaccaactatcctgaagatagtggt
gtggatgttcgtgatcttaatgatctcattacaaaattattttctccagttctgttggaa
acacactgtattgagaacggcctagagtggcatgaatatatgaagacatacttgctttac
ccagagaaattgtggcaaggcctgcctaatgtgggaaacacctgctatataaatgttgta
ttacagtctctatgctcaataccactgtttattaatgatttattcaaccagggtttccca
tggattaaagctcccaaagatgattttaacatgctcttgatgcaactgcttgttttgaaa
gatatttacaacgcaagatttagacagaagttacttataggtattacaaaagccctcccc
atatttggagagatatttgctgttgacaggcagaatgatgctcatgagtttttaagtctc
tgtttagttcagttgaaggagactttccaaagagtaaccatgatgtggcagtctgaaaat
gattcgggggatttttacttacttaaagacatttttgctgattatgctactatcaacaaa
atgcccgtttgtcctgttaccaataattttgaatttgagttgctaagctccattttttgt
aaagcttgtggcctgactctttttaagggagaaccaagtagatacctttctatcaacatt
ccccaaggagggaaagacatgtccatccagtccactttagatcttttctttagtgcagag
gagcttgagcataggtgtgaaaagtgtttgtacaacaaatctgtttcatttcacaggttt
ggccggctacccagggtaattattgttcatctgaaacgctatcactttaatgagtcatgg
gtaatgaagaaggatgagcggcccatccttgtttccaaatacttaaggctgtcttgtcac
tgtagcaaaagcacaaaaccgcccccaccccttcgcccaggtgaacatgttaagaatctt
gacttattaaaaccccttgaagtgttgggttccgaaatactcaaattgccttttaattca
gtgaggacctctagatccaagggtttcgaaactataaacatcacatcaaacagggagtca
gaagcacaaagtgggaaaagagtctctgaagtgttgagtggaaaagtgcagcaggaaaat
tcagggaaaggtgacacagcacatatagttgggtcagaacttacaaaggagactgagaaa
ctcaagaaacatgaggaagagcatagacccagtgatttagattctggtagtatcagggag
gcccaaaagtaccaacaggctgagaaatgtaacgaagggagaagtgataagcagatttcc
ctagaggcacttactcaaagccgtccaaaaccaatctcccaggaacagacagaaaacctt
gggaaaactacactgtcacatacccaggatagtagtcagagttcacagagctcatcagat
tccagtaagagctcccgatgcagtgatgatctcgataagaaggcaaagcctacacgcaag
gtggatccaacaaagttaaataaaaaagaagataatgtttacaggcttgttaatattatc
aaccatattgggaacagtcccaatggaggccactacatcaatgatgcctttgacttcaag
aggcagagttggttcacttatagtgatctacatgtaacaagaacccaagaggactttgta
tataggggtcggagttctactgggtatgtcttcttttacatgcataatgatatatttgaa
gagctcttggcaaaggaaactcagtctaccagcacatccaagggttag

DBGET integrated database retrieval system