KEGG   Mus musculus (mouse): 83771Help
Entry
83771             CDS       T01002                                 

Gene name
Tas1r3, Sac, T1r3
Definition
(RefSeq) taste receptor, type 1, member 3
  KO
K04626  
taste receptor type 1 member 3
Organism
mmu  Mus musculus (mouse)
Pathway
Taste transduction
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    83771 (Tas1r3)
  Sensory system
   04742 Taste transduction
    83771 (Tas1r3)
G protein-coupled receptors [BR:mmu04030]
 Class C. Metabotropic glutamate receptor family
  Chemoreception
   Taste type 1
    83771 (Tas1r3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 E2; 4 87.65 cM
AA seq 858 aa AA seqDB search
MPALAIMGLSLAAFLELGMGASLCLSQQFKAQGDYILGGLFPLGSTEEATLNQRTQPNSI
PCNRFSPLGLFLAMAMKMAVEEINNGSALLPGLRLGYDLFDTCSEPVVTMKSSLMFLAKV
GSQSIAAYCNYTQYQPRVLAVIGPHSSELALITGKFFSFFLMPQVSYSASMDRLSDRETF
PSFFRTVPSDRVQLQAVVTLLQNFSWNWVAALGSDDDYGREGLSIFSSLANARGICIAHE
GLVPQHDTSGQQLGKVLDVLRQVNQSKVQVVVLFASARAVYSLFSYSIHHGLSPKVWVAS
ESWLTSDLVMTLPNIARVGTVLGFLQRGALLPEFSHYVETHLALAADPAFCASLNAELDL
EEHVMGQRCPRCDDIMLQNLSSGLLQNLSAGQLHHQIFATYAAVYSVAQALHNTLQCNVS
HCHVSEHVLPWQLLENMYNMSFHARDLTLQFDAEGNVDMEYDLKMWVWQSPTPVLHTVGT
FNGTLQLQQSKMYWPGNQVPVSQCSRQCKDGQVRRVKGFHSCCYDCVDCKAGSYRKHPDD
FTCTPCNQDQWSPEKSTACLPRRPKFLAWGEPVVLSLLLLLCLVLGLALAALGLSVHHWD
SPLVQASGGSQFCFGLICLGLFCLSVLLFPGRPSSASCLAQQPMAHLPLTGCLSTLFLQA
AETFVESELPLSWANWLCSYLRGLWAWLVVLLATFVEAALCAWYLIAFPPEVVTDWSVLP
TEVLEHCHVRSWVSLGLVHITNAMLAFLCFLGTFLVQSQPGRYNRARGLTFAMLAYFITW
VSFVPLLANVQVAYQPAVQMGAILVCALGILVTFHLPKCYVLLWLPKLNTQEFFLGRNAK
KAADENSGGGEAAQGHNE
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgccagctttggctatcatgggtctcagcctggctgctttcctggagcttgggatgggg
gcctctttgtgtctgtcacagcaattcaaggcacaaggggactacatactgggcgggcta
tttcccctgggctcaaccgaggaggccactctcaaccagagaacacaacccaacagcatc
ccgtgcaacaggttctcaccccttggtttgttcctggccatggctatgaagatggctgtg
gaggagatcaacaatggatctgccttgctccctgggctgcggctgggctatgacctattt
gacacatgctccgagccagtggtcaccatgaaatccagtctcatgttcctggccaaggtg
ggcagtcaaagcattgctgcctactgcaactacacacagtaccaaccccgtgtgctggct
gtcatcggcccccactcatcagagcttgccctcattacaggcaagttcttcagcttcttc
ctcatgccacaggtcagctatagtgccagcatggatcggctaagtgaccgggaaacgttt
ccatccttcttccgcacagtgcccagtgaccgggtgcagctgcaggcagttgtgactctg
ttgcagaacttcagctggaactgggtggccgccttagggagtgatgatgactatggccgg
gaaggtctgagcatcttttctagtctggccaatgcacgaggtatctgcatcgcacatgag
ggcctggtgccacaacatgacactagtggccaacagttgggcaaggtgctggatgtacta
cgccaagtgaaccaaagtaaagtacaagtggtggtgctgtttgcctctgcccgtgctgtc
tactccctttttagttacagcatccatcatggcctctcacccaaggtatgggtggccagt
gagtcttggctgacatctgacctggtcatgacacttcccaatattgcccgtgtgggcact
gtgcttgggtttttgcagcggggtgccctactgcctgaattttcccattatgtggagact
caccttgccctggccgctgacccagcattctgtgcctcactgaatgcggagttggatctg
gaggaacatgtgatggggcaacgctgtccacggtgtgacgacatcatgctgcagaaccta
tcatctgggctgttgcagaacctatcagctgggcaattgcaccaccaaatatttgcaacc
tatgcagctgtgtacagtgtggctcaagcccttcacaacaccctacagtgcaatgtctca
cattgccacgtatcagaacatgttctaccctggcagctcctggagaacatgtacaatatg
agtttccatgctcgagacttgacactacagtttgatgctgaagggaatgtagacatggaa
tatgacctgaagatgtgggtgtggcagagccctacacctgtattacatactgtgggcacc
ttcaacggcacccttcagctgcagcagtctaaaatgtactggccaggcaaccaggtgcca
gtctcccagtgttcccgccagtgcaaagatggccaggttcgccgagtaaagggctttcat
tcctgctgctatgactgcgtggactgcaaggcgggcagctaccggaagcatccagatgac
ttcacctgtactccatgtaaccaggaccagtggtccccagagaaaagcacagcctgctta
cctcgcaggcccaagtttctggcttggggggagccagttgtgctgtcactcctcctgctg
ctttgcctggtgctgggtctagcactggctgctctggggctctctgtccaccactgggac
agccctcttgtccaggcctcaggtggctcacagttctgctttggcctgatctgcctaggc
ctcttctgcctcagtgtccttctgttcccagggcggccaagctctgccagctgccttgca
caacaaccaatggctcacctccctctcacaggctgcctgagcacactcttcctgcaagca
gctgagacctttgtggagtctgagctgccactgagctgggcaaactggctatgcagctac
cttcggggactctgggcctggctagtggtactgttggccacttttgtggaggcagcacta
tgtgcctggtatttgatcgctttcccaccagaggtggtgacagactggtcagtgctgccc
acagaggtactggagcactgccacgtgcgttcctgggtcagcctgggcttggtgcacatc
accaatgcaatgttagctttcctctgctttctgggcactttcctggtacagagccagcct
ggccgctacaaccgtgcccgtggtctcaccttcgccatgctagcttatttcatcacctgg
gtctcttttgtgcccctcctggccaatgtgcaggtggcctaccagccagctgtgcagatg
ggtgctatcctagtctgtgccctgggcatcctggtcaccttccacctgcccaagtgctat
gtgcttctttggctgccaaagctcaacacccaggagttcttcctgggaaggaatgccaag
aaagcagcagatgagaacagtggcggtggtgaggcagctcagggacacaatgaatga

DBGET integrated database retrieval system