KEGG   Mus musculus (mouse): 84036Help
Entry
84036             CDS       T01002                                 

Gene name
Kcnn1, AI854248, KCa2.1, SK1
Definition
(RefSeq) potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1
  KO
K04942  
potassium intermediate/small conductance calcium-activated channel subfamily N member 1
Organism
mmu  Mus musculus (mouse)
Pathway
Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    84036 (Kcnn1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNN, KCa2-3.x (Small conductance)
   84036 (Kcnn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8; 8 B3.3
AA seq 538 aa AA seqDB search
MSSHSHNGSVGQPLGSGPGFLGWEPVDPEAGRPLQPTQGPGLQMVAKGQPVRLSPGGSRG
HPQEQEEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMV
TETELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMT
WERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLA
RVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVR
VCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVV
AVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRK
HQRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARL
AALESRLDVLGASLQALPGLIAQAICPLPPPWPGPGHLATATQSPQSHWLPTMGSDCG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccacagccacaatggcagcgtggggcagcctctgggcagcgggcctggattc
ctgggctgggagcctgtggaccctgaggcaggccgccccctgcagcccacccaaggccca
ggcctgcagatggtggccaagggtcagcctgtcaggctgtcacccggtggttccaggggc
cacccccaggagcaggaggaggaagaggaagaggaggaggaggaggaggacaagacaggc
tcagggaagcccccaacagtcagccaccgcctgggacaccgcagggccctctttgaaaag
cgtaaacggctcagtgactatgcgctcatctttggcatgtttgggattgtcgtcatggtg
acagaaacagagctgtcctggggtgtatacaccaaggagtcactctgctcttttgctctg
aaatgcctcatcagcctgtccactgtcatcttgcttggccttgtcatcctgtaccacgcc
cgagagatccagctgttcttggtggacaatggtgccgacgactggcgtatcgccatgacg
tgggagcgcgtgtccctgatctcgctggagttggtcgtgtgtgccatccacccggtgccc
ggccactatcgcttcacgtggacggcacgactggccttctctctggtgccgtcggcagcc
gaggcagacctggatgtgctgctgtccatccccatgttcctgcgcctctacctgctggct
cgggtcatgctcctgcacagccgcatcttcaccgatgcatccagccgcagcatcggggcc
cttaaccgcgtcaccttcaacacacgcttcgtcaccaagacgctcatgaccatctgcccc
ggcactgtgttgttggtcttcagcgtctcctcctggatcgttgctgcgtggacagtgcgc
gtgtgtgagaggtaccacgataagcaggaagtgaccagcaacttcctgggagccatgtgg
ctcatctccatcaccttcttgtccattggctatggagacatggtgccgcatacctactgt
gggaagggtgtgtgtctgctcactggcatcatgggagcaggctgcactgcactcgtggtg
gccgtcgtggctcggaagttggaactcaccaaggctgagaaacacgtgcacaacttcatg
atggacacacagctcaccaagcgggtcaaaaatgctgctgcaaacgttctcagggagaca
tggctcatctacaaacacaccaggctggtgaagaagccagaccaaggccgggttcggaaa
caccagcgtaagttccttcaggccatccatcaggctcagaagctccgaagtgtgaagatt
gaacaagggaaggtgaacgatcaggccaacacgctggctgagctggccaaggcacagagc
atcgcatatgaggtggtgtcagagctgcaggcccagcaggaggagttggaggcacgccta
gccgccttggagagccgactggatgtcctgggtgcctccctgcaggctctaccaggcctt
atagcccaagccatatgccctctaccaccaccctggcctgggcctggtcacctggccaca
gccacccagagcccacaaagccactggctgcccaccatgggatcagactgtgggtga

DBGET integrated database retrieval system