KEGG   Mus musculus (mouse): 84092Help
Entry
84092             CDS       T01002                                 

Gene name
Usp8, AI574262, AW557536, Ubpy, mKIAA0055
Definition
(RefSeq) ubiquitin specific peptidase 8 (EC:3.4.19.12)
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84092 (Usp8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     84092 (Usp8)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   84092 (Usp8)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    84092 (Usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 F1
AA seq 1080 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKTSTKNYIHSAQKIFKTAEECRLDRDEERAY
VLYMKYVAVYNLIKKRPDFKQQQDYYLSILGPANIKKAIEEAERLSESLKLRYEEAEVRK
QLEEKDRREEEQLQQQKRQEMGREDSGAAAKRSVENLLDSKTKTQRINGEKSEGAAAAER
GAITAKELYTMMMDKNTSLIIMDARKIQDYQHSCILDSLSVPEEAISPGVTASWIEANLS
DDSKDTWKKRGSVDYVVLLDWFSSAKDLLLGTTLRSLKDALFKWESKTVLRHEPLVLEGG
YENWLLCYPQFTTNAKVTPPPRSRAEEVSVSLDFTYPSLEEPVPSKLPTQMPPPPIETNE
KALLVTDQDEKLRLSTQPALAGPGAAPRAEASPIIQPAPATKSVPQVDRTKKPSVKLPED
HRIKSENTDQSGRVLSDRSTKPVFPSPTTMLTDEEKARIHQETALLMEKNKQEKELWDKQ
QKEQKEKLRREEQERKAGKTQDADERDSTENQHKAKDGQEKKDSKQTKTEDRELSADGAQ
EATGTQRQSKSEHEASDAKVPVEGKRCPTSEAQKRPADVSPASVSGELNAGKAQREPLTR
ARSEEMGRIVPGLPLGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKV
KPQVPAERDREPSKLKRSYSSPDITQALQEEEKRRPAVTPMVNRENKPPCYPKAEISRLS
ASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSN
LLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKVTIGKINDQFAGSSQQDSQELLLFLMD
GLHEDLNKADNRKRHKEENNEHLDDLQAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLT
CRRRSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKI
EIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNSLKKYNLFSVSN
HYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFYTSLGPRITDVAT
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtagcttcagttcctaaagaactctacctcagttcttcactaaaagacctc
aataagaagaccgaagttaaacctgagaaaaccagcaccaagaattatatacacagcgcg
cagaagatcttcaagacagcagaagaatgcagactagatcgtgatgaggaaagggcctat
gtgctttatatgaaatatgtggcagtttataatcttatcaaaaagagacctgatttcaag
caacagcaggattattatctttcaatacttggacctgcaaacatcaaaaaagctattgaa
gaagctgaaagactctccgaaagccttaaactaagatacgaagaggctgaagttcggaaa
caacttgaagaaaaggacagacgggaggaagagcagctgcagcaacagaaaaggcaggag
atggggagagaggacagcggtgcggcagccaaacgctctgtggaaaatttactggattcc
aaaaccaaaacccaaaggattaacggcgagaagagtgaaggagctgcagctgcagagaga
ggagccatcacagcaaaggaactatatacgatgatgatggataaaaacacaagcttaatt
ataatggatgctcgaaaaatacaggattatcagcattcctgtatcttggattctctcagt
gttcctgaagaagctatcagtccaggagtcactgctagttggattgaagcaaacctctca
gatgattctaaagacacatggaaaaagagggggagtgtggactatgtggtccttctcgac
tggtttagttcagcgaaagatttgctgcttgggaccactctacggagtctgaaagatgca
cttttcaagtgggaaagtaaaactgtcctgcgccatgagcctttggtgttggagggcggc
tatgaaaactggctgctttgctacccgcagtttacaaccaatgctaaggtcactccaccc
cctcggagcagagctgaagaggtgtctgtctcattggattttacttatccctcattggaa
gaaccagttccttccaaacttcctacccagatgccacctcctcctatagaaacaaatgaa
aaggcactgttggtaactgatcaagatgaaaagctgagactgtcaacccagccagctcta
gctggacctggtgcggctcccagagctgaagcctcacccataattcagccagcgcctgct
acaaagagtgttccacaggttgatcgtacgaaaaaaccgtcagtcaagttgcctgaagat
catagaataaaatctgaaaatacagatcagagtggaagagttctttctgatcgatccacc
aagccagtatttccctctccaaccaccatgttaacagatgaagaaaaggctcgtattcat
caagaaactgcccttcttatggaaaagaataaacaggagaaggaactttgggacaagcag
cagaaggaacagaaagagaagctgagaagggaggaacaagagcgcaaagctggaaagaca
caggatgcagatgaacgtgactccactgagaatcagcacaaagcaaaggatggacaagag
aaaaaagacagcaaacagaccaagacggaagacagagagctttcagcagacggggcccag
gaagccacaggaacacaaagacaaagtaagagtgagcatgaagcttctgatgctaaggta
cctgtggaaggtaaaaggtgtcccacgtcagaggcgcagaagaggccagcagatgtgtcc
cctgcatccgtgtcaggagagctgaatgcaggcaaggctcagcgagaacctttgacgaga
gcacgaagtgaagaaatggggagaattgtgccgggactgcctttgggctgggccaagttt
cttgatccaatcaccgggacctttcgttactaccattcccccacaaacacagttcatatg
tatccacctgaaatggctccttcgtctgcacctccttccaccccgcccactcacaaagtc
aagccccaggtccctgccgagcgggacagggagccatcgaaactgaagcgctcctactcc
tcaccagatatcactcaggccctgcaggaggaggagaagaggaggccggcagtgaccccg
atggtcaaccgggaaaacaagccaccatgttaccctaaagctgagatttcgaggctttct
gcttctcagattcggaacctcaatcctgtatttggaggatcaggaccagctcttactgga
cttcgtaatttgggaaatacttgttacatgaactcaatcttgcagtgcctgtgtaatgct
ccacatctggctgattatttcaaccgaaactgctaccaggatgatatcaacaggtcaaat
ttgttggggcataaaggtgaagtggcagaagaatttggtataatcatgaaagcactgtgg
acaggacagtatagatacatcagtccaaaggactttaaagtcaccattggtaagattaat
gaccagtttgcaggctccagccaacaggattcacaagagctgcttctgttcctcatggat
ggcctgcatgaggatctgaataaggctgacaatcggaagaggcacaaggaagagaacaac
gagcacctggatgacctgcaggcggccgagcacgcctggcagaagcacaagcagctcaac
gagtccatcatcgtggccctgttccagggccagttcaagtccacagtgcagtgcctcacc
tgccgcaggaggtcgcgcaccttcgaggccttcatgtacttgtctttgccgctagcatcc
acaagtaaatgtactctacaggactgccttagattattttccaaagaagaaaagcttaca
gataacaacagattttactgcagccattgccgagctcggcgggattctctaaagaaaata
gaaatctggaaattacctcctgtgctgttagtgcacctgaaacgattttcctatgacggc
aggtggaagcagaagctgcaaacatccgtggatttcccattggaaaatcttgacctgtca
cagtacgttattggtccaaaaaacagcttgaagaaatataacttgttttctgtttcaaac
cactacggcgggctagacggaggccactacacagcctactgtaagaacgcggcaaggcag
cgctggtttaagtttgatgaccatgaagtttctgatatctctgtgtcttctgtgaggtca
tcagcagcttatatcctcttttatacttccctgggaccacgcataactgatgtagccaca
tag

DBGET integrated database retrieval system