KEGG   Mus musculus (mouse): 84505Help
Entry
84505             CDS       T01002                                 

Gene name
Setdb1, AU022152, ESET, KMT1E, mKIAA0067
Definition
(RefSeq) SET domain, bifurcated 1 (EC:2.1.1.43)
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    84505 (Setdb1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    84505 (Setdb1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     84505 (Setdb1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     84505 (Setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    84505 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F2
AA seq 1308 aa AA seqDB search
MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQYIDEELEKMDCIQQRKKQ
LAELETWVLQKESEVAYVDRLFDDASREVTNCESLVKDFYSKLGLQYHDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTGTGIQFKPMEPLQPIAPPAPLPIPPLSPQAADTESLESQL
AQSRKQVAKKSTSFRPGSVGSGHSSPTSSTLSENVSAGKLGINQTYRSPLASVTSTPASA
APPVPPVPPGPPTPPGPPAPPGPLAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTC
LSRIRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIE
RYLFETGCDFLFLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPP
PQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQVNPN
SGYQYKRLEECLPTGVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDD
IAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPTSSDSSG
VDMKDQEDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENELSEM
TSKDSRPPDLGPPHVPIPSSVSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRS
SFKTSEGGDGRAGGGRGEAERASTSGLSFKDEGDNKQPKKEDPENRNKMPVVTEGSQNHG
HNPPMKSEGLRRSASKMSVLQSQRVVTSTQSNPDDILTLSSSTESEGESGTSRKPTAGHT
SATAVDSDDIQTISSGSDGDDFEDKKNLSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMA
SVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLR
FPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcatgagtttggctgcagcgccagctgcagctgactctgca
gagattgctgagctgcagcaggcggtggttgaagagctgggtatctctatggaggaactt
cgtcagtacattgatgaggaactggaaaagatggactgcatacagcagcgcaagaagcag
ctcgcagagctggagacgtgggtactacagaaagagtctgaagtggcttatgttgatcgg
ctgtttgatgatgcatccagggaagtgactaactgtgagtctttggtgaaggatttctac
tctaagctgggactacagtatcatgacagtagctctgaggatgaagcttcccggcccaca
gagatcattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaactccaaaagaccagaagcttcgtgaagctatggctgccttaagaaaatca
gctcaagatgtccagaagttcatggatgctgtcaacaagaaaagcagttctcaagatcta
cataaaggaaccttgggtcaggtgtctggagaactgagcaaagatggggacctgatagtc
agcatgcggattctgggcaagaagaggactaagacatggcacaaaggcacccttattgcc
atccagactgttgggctaggaaaaaaatacaaagtgaaatttgacaacaaaggaaagagt
ctgctatctgggaaccatattgcctatgattaccaccctcccgctgacaagctgtttgtg
ggcagtcgagtggtggccaagtacaaagatggaaatcaggtctggctttatgctggcatt
gtagctgagacccctaacgtcaagaacaagctcagatttttaattttttttgatgatggc
tatgcttcctatgtcactcagtcagagctttatcccatttgccgaccactaaaaaagact
tgggaggacatagaagatagctcctgccgagacttcatagaggaatatatcactgcctat
ccaaaccgcccaatggtacttctcaagagtgggcagcttatcaagactgagtgggaaggc
acatggtggaagtctcgagttgaagaggtggatggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgagtggatatatcgaggctctacacgcctggaacctatgtttagt
atgaagacatcctcagcctctgcaatggagaagaagcaaggggggcaactcagaacccgt
cctaatatgggtgctgtgaggagcaaaggtcctgttgttcagtatacacaggatctaact
ggtactggaatccagtttaagcccatggagcccctacagcctatagctccaccggcccca
cttcctatacctcctctttccccccaagcagctgacactgaaagcttagaaagccaactt
gcacaatcacggaaacaagtagccaagaagagcacatcattccgaccaggatctgtgggc
tccggccattcctcccctacttcatccacactcagtgaaaatgtgtctgctgggaaactt
gggataaaccagacatatcggtcacctttggcctcagtaacatctaccccagcatctgca
gcccctccagtccctccagtcccaccagggcctccaacccctccagggcctccagctcct
ccagggcctctagctcctccagccttccatggcatgttagagcgggcaccagctgagccc
tcctaccgagcccccatggagaagcttttctatttacctcatgtctgcagttacacttgt
ttgtcccggatcagacccatgagaaacgaacagtatcggggcaagaaccctctattagtt
ccacttctgtatgacttccggaggatgacagcacggcgcagagttaaccgcaaaatgggc
tttcatgtaatctataagacaccctgtggtctctgccttcggacgatgcaggagatagag
cgctacctttttgagactggctgtgactttctgttcctggagatgttctgtttggatcca
tatgttcttgttgacagaaagtttcaaccctttaagcctttttactatattttggacatc
acctatggcaaggaagatgttcccctgtcctgtgttaatgagattgacacaactccccca
ccccaggtggcctacagcaaggaacgcattcctggcaagggtgttttcattaacacaggc
cctgaatttctggttggctgtgactgcaaggatgggtgtcgggataaatccaaatgtgcc
tgccaccagctaactatccaggccacagcctgtaccccagggggccaagtcaaccctaac
tctggctaccagtataaaagactagaagagtgtctgcccacaggggtttatgagtgtaac
aaacgctgcaattgtgacccaaacatgtgcacaaatcggttggtgcagcatggtctgcag
gttcgactacagctgtttaagacacagaacaagggctggggtatccgctgcttggatgat
attgccaaaggctcttttgtctgcatttatgcaggcaaaatcctgacagatgactttgca
gacaaagaaggcctggagatgggtgatgagtactttgcaaatctggaccacattgaaagt
gtggagaacttcaaggaaggatatgagagtgatgtccccacttcctctgacagcagtggg
gtagatatgaaggaccaggaagatggcaacagcggttcagaggaccctgaagaatccaat
gatgacagctctgatgataacttctgtaaggatgaggacttcagcaccagttcagtgtgg
cgtagctatgctacccggaggcagactcggggtcaaaaggagaatgaattgtctgagatg
acttccaaggactcccgccccccagacctcgggcctccacatgttcctatcccttcctca
gtatctgtagggggctgcaatccaccttcctctgaagagacacccaagaacaaggtggcc
tcgtggttgagttgcaatagtgtcagtgaaggtggatttgctgactctgacagccgttct
tccttcaagactagtgaaggtggagatggccgtgctgggggaggccggggagaggctgaa
agggcctctacctcaggattgagcttcaaggatgaaggagacaataagcagcctaaaaaa
gaggaccctgagaaccgaaacaagatgccagtagttactgaaggctctcagaatcatgga
cataatcctcccatgaagtctgaagggcttcgccgatcagctagtaaaatgtctgtgctc
cagagccagcgagttgtgacttctactcagtcaaaccctgatgacatcctgacactgtcc
agcagcacagagagtgagggggaaagtggaaccagccgaaagcccactgctggtcacact
tcagccacagctgttgatagtgatgacatccagaccatctcttctggctctgacggtgat
gactttgaggacaagaagaacttgtcaggaccaacaaagcgccaggtggcagtaaaatca
acccgaggctttgctcttaaatcaacccatggtattgccattaaatcaaccaacatggct
tccgtggacaagggggagagtgcaccagttcgtaagaacacacgccagttctatgatggt
gaagagtcttgctacatcattgatgccaaacttgaaggcaacctaggccgctacctcaat
cacagttgcagccccaacctgtttgtccagaatgtgtttgtggatacccatgatcttcgc
ttcccttgggtggccttctttgccagcaagagaatccgggctggaacagaactcacttgg
gactacaactacgaagtgggcagtgtggaaggcaaggagctgctgtgctgctgtggggcc
attgaatgcagagggagacttctttag

DBGET integrated database retrieval system