KEGG   Mus musculus (mouse): 84505Help
Entry
84505             CDS       T01002                                 

Gene name
Setdb1, AU022152, ESET, KMT1E, mKIAA0067
Definition
SET domain, bifurcated 1 (EC:2.1.1.43)
Orthology
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    84505 (Setdb1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    84505 (Setdb1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     84505 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F2
AA seq 1308 aa AA seqDB search
MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQYIDEELEKMDCIQQRKKQ
LAELETWVLQKESEVAYVDRLFDDASREVTNCESLVKDFYSKLGLQYHDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTGTGIQFKPMEPLQPIAPPAPLPIPPLSPQAADTESLESQL
AQSRKQVAKKSTSFRPGSVGSGHSSPTSSTLSENVSAGKLGINQTYRSPLASVTSTPASA
APPVPPVPPGPPTPPGPPAPPGPLAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTC
LSRIRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIE
RYLFETGCDFLFLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPP
PQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQVNPN
SGYQYKRLEECLPTGVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDD
IAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPTSSDSSG
VDMKDQEDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENELSEM
TSKDSRPPDLGPPHVPIPSSVSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRS
SFKTSEGGDGRAGGGRGEAERASTSGLSFKDEGDNKQPKKEDPENRNKMPVVTEGSQNHG
HNPPMKSEGLRRSASKMSVLQSQRVVTSTQSNPDDILTLSSSTESEGESGTSRKPTAGHT
SATAVDSDDIQTISSGSDGDDFEDKKNLSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMA
SVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLR
FPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcatgagtttggctgcagcgccagctgcagctgactctgca
gagattgctgagctgcagcaggcggtggttgaagagctgggtatctctatggaggaactt
cgtcagtacattgatgaggaactggaaaagatggactgcatacagcagcgcaagaagcag
ctcgcagagctggagacgtgggtactacagaaagagtctgaagtggcttatgttgatcgg
ctgtttgatgatgcatccagggaagtgactaactgtgagtctttggtgaaggatttctac
tctaagctgggactacagtatcatgacagtagctctgaggatgaagcttcccggcccaca
gagatcattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaactccaaaagaccagaagcttcgtgaagctatggctgccttaagaaaatca
gctcaagatgtccagaagttcatggatgctgtcaacaagaaaagcagttctcaagatcta
cataaaggaaccttgggtcaggtgtctggagaactgagcaaagatggggacctgatagtc
agcatgcggattctgggcaagaagaggactaagacatggcacaaaggcacccttattgcc
atccagactgttgggctaggaaaaaaatacaaagtgaaatttgacaacaaaggaaagagt
ctgctatctgggaaccatattgcctatgattaccaccctcccgctgacaagctgtttgtg
ggcagtcgagtggtggccaagtacaaagatggaaatcaggtctggctttatgctggcatt
gtagctgagacccctaacgtcaagaacaagctcagatttttaattttttttgatgatggc
tatgcttcctatgtcactcagtcagagctttatcccatttgccgaccactaaaaaagact
tgggaggacatagaagatagctcctgccgagacttcatagaggaatatatcactgcctat
ccaaaccgcccaatggtacttctcaagagtgggcagcttatcaagactgagtgggaaggc
acatggtggaagtctcgagttgaagaggtggatggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgagtggatatatcgaggctctacacgcctggaacctatgtttagt
atgaagacatcctcagcctctgcaatggagaagaagcaaggggggcaactcagaacccgt
cctaatatgggtgctgtgaggagcaaaggtcctgttgttcagtatacacaggatctaact
ggtactggaatccagtttaagcccatggagcccctacagcctatagctccaccggcccca
cttcctatacctcctctttccccccaagcagctgacactgaaagcttagaaagccaactt
gcacaatcacggaaacaagtagccaagaagagcacatcattccgaccaggatctgtgggc
tccggccattcctcccctacttcatccacactcagtgaaaatgtgtctgctgggaaactt
gggataaaccagacatatcggtcacctttggcctcagtaacatctaccccagcatctgca
gcccctccagtccctccagtcccaccagggcctccaacccctccagggcctccagctcct
ccagggcctctagctcctccagccttccatggcatgttagagcgggcaccagctgagccc
tcctaccgagcccccatggagaagcttttctatttacctcatgtctgcagttacacttgt
ttgtcccggatcagacccatgagaaacgaacagtatcggggcaagaaccctctattagtt
ccacttctgtatgacttccggaggatgacagcacggcgcagagttaaccgcaaaatgggc
tttcatgtaatctataagacaccctgtggtctctgccttcggacgatgcaggagatagag
cgctacctttttgagactggctgtgactttctgttcctggagatgttctgtttggatcca
tatgttcttgttgacagaaagtttcaaccctttaagcctttttactatattttggacatc
acctatggcaaggaagatgttcccctgtcctgtgttaatgagattgacacaactccccca
ccccaggtggcctacagcaaggaacgcattcctggcaagggtgttttcattaacacaggc
cctgaatttctggttggctgtgactgcaaggatgggtgtcgggataaatccaaatgtgcc
tgccaccagctaactatccaggccacagcctgtaccccagggggccaagtcaaccctaac
tctggctaccagtataaaagactagaagagtgtctgcccacaggggtttatgagtgtaac
aaacgctgcaattgtgacccaaacatgtgcacaaatcggttggtgcagcatggtctgcag
gttcgactacagctgtttaagacacagaacaagggctggggtatccgctgcttggatgat
attgccaaaggctcttttgtctgcatttatgcaggcaaaatcctgacagatgactttgca
gacaaagaaggcctggagatgggtgatgagtactttgcaaatctggaccacattgaaagt
gtggagaacttcaaggaaggatatgagagtgatgtccccacttcctctgacagcagtggg
gtagatatgaaggaccaggaagatggcaacagcggttcagaggaccctgaagaatccaat
gatgacagctctgatgataacttctgtaaggatgaggacttcagcaccagttcagtgtgg
cgtagctatgctacccggaggcagactcggggtcaaaaggagaatgaattgtctgagatg
acttccaaggactcccgccccccagacctcgggcctccacatgttcctatcccttcctca
gtatctgtagggggctgcaatccaccttcctctgaagagacacccaagaacaaggtggcc
tcgtggttgagttgcaatagtgtcagtgaaggtggatttgctgactctgacagccgttct
tccttcaagactagtgaaggtggagatggccgtgctgggggaggccggggagaggctgaa
agggcctctacctcaggattgagcttcaaggatgaaggagacaataagcagcctaaaaaa
gaggaccctgagaaccgaaacaagatgccagtagttactgaaggctctcagaatcatgga
cataatcctcccatgaagtctgaagggcttcgccgatcagctagtaaaatgtctgtgctc
cagagccagcgagttgtgacttctactcagtcaaaccctgatgacatcctgacactgtcc
agcagcacagagagtgagggggaaagtggaaccagccgaaagcccactgctggtcacact
tcagccacagctgttgatagtgatgacatccagaccatctcttctggctctgacggtgat
gactttgaggacaagaagaacttgtcaggaccaacaaagcgccaggtggcagtaaaatca
acccgaggctttgctcttaaatcaacccatggtattgccattaaatcaaccaacatggct
tccgtggacaagggggagagtgcaccagttcgtaagaacacacgccagttctatgatggt
gaagagtcttgctacatcattgatgccaaacttgaaggcaacctaggccgctacctcaat
cacagttgcagccccaacctgtttgtccagaatgtgtttgtggatacccatgatcttcgc
ttcccttgggtggccttctttgccagcaagagaatccgggctggaacagaactcacttgg
gactacaactacgaagtgggcagtgtggaaggcaaggagctgctgtgctgctgtggggcc
attgaatgcagagggagacttctttag

DBGET integrated database retrieval system