KEGG   Mus musculus (mouse): 93747Help
Entry
93747             CDS       T01002                                 

Gene name
Echs1, C80529
Definition
enoyl Coenzyme A hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    93747 (Echs1)
   01212 Fatty acid metabolism
    93747 (Echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    93747 (Echs1)
   00650 Butanoate metabolism
    93747 (Echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    93747 (Echs1)
   00071 Fatty acid degradation
    93747 (Echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    93747 (Echs1)
   00310 Lysine degradation
    93747 (Echs1)
   00380 Tryptophan metabolism
    93747 (Echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    93747 (Echs1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     93747 (Echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F4; 7
AA seq 290 aa AA seqDB search
MAALRALLPRACSSLLSSVRCPELRRFASGANFQYIITEKKGKNSSVGLIQLNRPKALNA
LCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHW
DHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMA
KESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctgcgtgctctgctgcccagagcctgtagctcactgttgtcctcagtccgc
tgcccagaactacggcgcttcgcctcgggtgctaactttcagtacatcatcacagaaaag
aaaggaaagaatagcagcgtggggctgatccagttgaaccgccccaaagcactcaatgca
ctttgcaatggcctgattgaggagctcaaccaagcactggagacctttgagcaagatcct
gctgtgggtgccattgtgctcactggtggggataaggcctttgcagctggagctgacatc
aaggaaatgcagaaccgaacatttcaggactgttactccagcaagttcctgagccactgg
gaccacatcacccgggtcaagaaaccggtcatcgcagctgtcaatggttatgctcttggt
gggggttgtgaacttgccatgatgtgtgatatcatctatgctggcgagaaagcccagttc
ggacagccagaaatcctcctggggaccatcccaggtgctggaggcactcagagactcacc
cgagcagtcggcaaatcgctagcaatggagatggtcctcactggtgaccgcatctcagct
caggatgcaaagcaggcaggtcttgtaagcaagatttttcctgttgaaaaactggttgaa
gaagccatccaatgtgcagaaaaaattgccagcaattctaaaatcgtagtagccatggcg
aaagaatctgtgaatgcagcctttgagatgacgttaacagaaggaaataagctggagaag
aggcttttctattccacctttgccaccgatgaccggagagaagggatgactgcatttgta
gagaaaaggaaggccaacttcaaagaccactga

DBGET integrated database retrieval system