KEGG   Mus musculus (mouse): 94093Help
Entry
94093             CDS       T01002                                 

Gene name
Trim33, 8030451N04Rik, AI413936, Ecto, Tif1g
Definition
(RefSeq) tripartite motif-containing 33
  KO
K08883  
tripartite motif-containing protein 33 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     94093 (Trim33)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  TIF1 family [OT]
   94093 (Trim33)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    94093 (Trim33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F2.2
AA seq 1140 aa AA seqDB search
MAENKGGGEAESGGGGSGSAPVTAGAAGPTAQEAEPPLAAVLVEEEEEEGGRAGAEGGAA
GPDDGGVAAASSSSAPAASVPAASVGSAVPGGAASTPAPAAAPAPAPAPAPAPAPAPAPA
PGSSSGPPLGPPASLLDTCAVCQQSLQSRREAEPKLLPCLHSFCLRCLPEPERQLSVPIP
GGSNGDVQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCEDNASA
VGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGTSGQRPVFCPVHKQEQLKL
FCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQN
RIKEVNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLS
RQVKHVMNFTNWAIASGSSTALLYSKRLITFQLRHILKARCDPVPAANGAIRFHCDPTFW
AKNVVNLGNLVIESKPAPGYTPNVVVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQ
KHQQLQQMRLQQPPAPIPTTTATTQQHPRQAAPQMLQQQPPRLISVQTMQRGNMNCGAFQ
AHQMRLAQNAARIPGIPRHSAPQYSMMQPHLQRQHSNPGHAGPFPVVSAHNPINPTSPTT
ATMANANRGPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGS
HLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKSAHS
FKSDQVKVKQEPGTEEEICSFSGAVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESE
LDTLTGLENHVKTEPTDISESCKQSGLSNLVNGKSPIRNLMHRSARIGGDGNSKDDDPNE
DWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNMQ
HSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPVSIPNYYKIIKKPMDLSTVK
KKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKGDSEVAKAGK
AVALYFEDKLSEIYSDRTFTPLPEFEQDEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaacaaaggcggcggtgaggcagagagtggcggcgggggcagcggtagcgcg
ccggtaaccgccggggccgccgggcccacggcgcaggaggcggagccgcctctcgccgcg
gtgctggtggaggaggaggaggaggaaggcggcagggctggcgcggagggcggtgcggct
gggcccgacgacgggggggtggccgcggcctcctcaagctcggccccggccgcctcggtc
cccgcggcctcagtgggctccgcggtccccggaggcgcggcatcgacgccggctccagct
gctgccccagccccggccccggccccggccccggccccggcccccgctcccgccccggct
cctggttcctcgtcggggccacctctcggaccaccagcctcgcttctggacacctgcgcg
gtgtgtcagcagagcttgcagagccggcgcgaggcggagcccaagctgctcccctgcctg
cactccttctgcctgcgctgtctgccggagccggagcgccagctcagcgtgcccatccct
gggggcagcaacggtgacgtccagcaagttggtgtaatacggtgtccagtatgtcgtcaa
gaatgtagacagatagatcttgtggataattattttgtgaaagacacatctgaagctcct
agcagctctgatgagaaatcagaacaggtatgtactagttgtgaagataatgcaagtgca
gttggtttttgtgtagaatgtggagagtggctgtgtaagacatgcattgaagcacatcaa
agagtaaaattcactaaagaccacctgatcaggaaaaaagaagatgtctcagagtctgtt
ggaacatctggtcagcgcccagtgttttgtcctgtacataaacaagagcagttgaaacta
ttctgtgaaacgtgtgatagattgacgtgtagagactgtcaacttttggagcacaaagaa
cataggtatcagtttttagaagaggcttttcaaaatcagaaaggtgcaattgaaaatctg
ttggctaagcttcttgaaaagaagaattatgttcattttgcagctacacaagtgcagaat
aggattaaagaagtaaatgagactaacaaacgtgtagaacaggaaattaaagtggccatc
ttcacccttatcaatgaaattaataagaaaggaaaatctctcttgcaacagctagagaat
gttacaaaagaaagacagatgaagttactacagcagcagaatgatatcacaggcctctcc
cggcaggtgaagcatgttatgaactttacaaactgggccattgcaagtggcagcagcacg
gccctactttatagcaagcgtctgattacttttcagttacgtcatattttgaaagcccga
tgtgatcctgttcctgctgccaatggagcaattcgtttccattgtgatcccaccttctgg
gccaaaaatgtagtgaatttaggtaatctagtaatagagagtaagccagctcctggttat
actcctaatgttgtagttgggcaagttcctccagggacaaaccacattagtaaaacccct
ggacagattaatttagcacagcttcgactccagcacatgcagcaacaagtgtatgcacag
aaacatcagcagttacaacagatgagactgcagcaaccaccagctcctataccaacaaca
acagcaacaacccagcagcatcctaggcaagcagccccacagatgttacaacaacagcct
ccaagattgatcagtgtgcaaacaatgcaaagaggcaacatgaactgtggagcatttcaa
gcccatcaaatgagactggctcagaatgctgccagaataccagggatccccaggcacagt
gcccctcagtattccatgatgcagccacatctccaaagacaacattcaaatccaggacat
gctggaccgtttcctgttgtatcagcacacaacccaatcaacccaacaagtcccaccaca
gcaactatggcaaatgcaaatcgaggtcccaccagcccgtctgttacagcaatagaatta
ataccctcagtcaccaatccagaaaaccttccatcgttgccagatatcccacctatacag
ttggaagatgctggctcaagtagtttagataatctactgagtagatatatctcaggcagt
catctaccccctcagcctacaagtaccatgaatccttccccaggaccctctgcgttatca
cctggatcttcaggcttatccaattctcacacacctgtgagaccccctagcacgtctagt
actggcagtcgaggcagctgcggatcatcaggaagaactgctgagaaaagtgctcatagt
ttcaagtctgatcaggtgaaggtcaagcaggaacctgggactgaagaagagatatgcagc
ttttcaggagctgtgaaacaagagaagacagaggatggcaggaggagtgcctgtatgttg
agcagtcctgagagtagtttgacaccacctctttcaactaaccttcacctagagagtgag
ctggatacattaacaggcctggagaaccacgtgaagactgaacctacagatatcagtgaa
agctgcaaacagtcaggactcagtaacctagtcaatggaaagtctccaattcgaaacctc
atgcacaggtcggcaaggattggaggggatggcaatagcaaagatgatgacccaaatgaa
gactggtgtgccgtctgccagaacggaggggatcttttgtgttgtgagaaatgtccgaag
gtctttcatcttacctgtcatgttccaacacttctcagctttccaagtggagactggata
tgcacattttgcagagatattgggaagccagaagttgaatatgattgtgataatatgcag
catagtaagaaggggaaaactgcacaaggcttaagccctgtggaccaaaggaaatgtgaa
cgtcttctgctttacctctattgtcacgaattaagtattgaattccaggagcctgttcct
gtttcgataccaaactactataaaattataaagaaaccgatggatttatcaacggtgaag
aagaagcttcagaaaaaacattcccagcattaccaaatcccagatgactttgtggctgat
gtccgtttgatcttcaagaactgtgaaaggtttaatgaaatgatgaaagttgttcaagtt
tatgcagacacacaagagattaatttgaagggtgattcagaagtagctaaggcagggaaa
gcagttgcattgtactttgaagataaactctcagagatctactcagacaggaccttcact
cctttgccagagtttgagcaggacgaagatgatggtgaagtaacagaagactctgacgaa
gattttatacagcctcgtagaaaacgcctaaagtcagacgagagaccagtacatataaag
taa

DBGET integrated database retrieval system