KEGG   Mus musculus (mouse): 94181Help
Entry
94181             CDS       T01002                                 

Gene name
Nans, 4632418E04Rik, BB056474, Sas
Definition
(RefSeq) N-acetylneuraminic acid synthase (sialic acid synthase)
  KO
K05304  
sialic acid synthase [EC:2.5.1.56 2.5.1.57 2.5.1.132]
Organism
mmu  Mus musculus (mouse)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    94181 (Nans)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.56  N-acetylneuraminate synthase
     94181 (Nans)
    2.5.1.57  N-acylneuraminate-9-phosphate synthase
     94181 (Nans)
    2.5.1.132  3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphate synthase
     94181 (Nans)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 B1
AA seq 359 aa AA seqDB search
MPLELELCPGRWVGGKHPCFIIAEIGQNHQGDIDVAKRMIRTAKECGADCAKFQKSELEF
KFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYKELQSYAQEIGIFFTASGMDEMAVE
FLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFC
FLQCTSAYPLQPEDANLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHIT
LDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVK
IPAGTTLTLDMLTVKVGEPKGYPPEDIFNLAGKKVLVTIEEDDTVMEESVESHSKKIKA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggaactggagctgtgtcccgggcgctgggtgggtggaaagcacccgtgcttc
atcatcgcggagatcggccagaaccaccaaggagacatagatgtggccaagcgcatgatc
cgcactgccaaggagtgtggggccgactgcgctaagtttcagaagagcgagttggagttc
aagtttaaccggaaggccctggagagaccatatacttcgaagcattcatgggggaagacg
tatggggagcacaagcggcatctggaattcagccacgaccagtacaaggagctgcagagc
tatgcgcaggagatcggcatcttcttcactgcctctggcatggacgagatggcagttgag
tttctgcacgaactgaatgttccctttttcaaagttggatctggggacactaacaatttt
ccctacctggaaaagacagccaagaaaggtcgtcctatggtgatctccagcgggatgcag
tcaatggacaccatgaagcaagtctatcagatcgtgaagccgctgaatcccaacttctgc
ttcctccaatgcaccagcgcgtacccactacagcccgaggatgccaacctgcgcgtcatc
tcggaataccagaagctctttcccgacattcccatcgggtattccgggcacgagacgggc
atcgccatatctgtggccgccgtggctctgggggccaaggtgttggaacgtcacataacg
ttggacaagacctggaaggggagtgaccactcagcctcgctggagcctggggagctggca
gagctggtgcggtctgtgcgcctggtggagcgggccctgggctccccaaccaagcagctg
ctgccctgtgagatggcctgcaatgagaagctcggcaagtctgtggtagccaaagtgaaa
atcccagcaggcaccaccctgaccctggacatgctcactgtgaaggtgggggagcccaaa
ggctatcctcctgaagacatcttcaacctagcgggcaaaaaggtgctggtcactatcgaa
gaagatgacacggtcatggaagaatccgtggaaagtcacagcaagaaaatcaaggcttaa

DBGET integrated database retrieval system