KEGG   Mus musculus (mouse): 94215Help
Entry
94215             CDS       T01002                                 

Gene name
Ugt2a1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    94215 (Ugt2a1)
   00053 Ascorbate and aldarate metabolism
    94215 (Ugt2a1)
   00500 Starch and sucrose metabolism
    94215 (Ugt2a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    94215 (Ugt2a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    94215 (Ugt2a1)
   00860 Porphyrin and chlorophyll metabolism
    94215 (Ugt2a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    94215 (Ugt2a1)
   00982 Drug metabolism - cytochrome P450
    94215 (Ugt2a1)
   00983 Drug metabolism - other enzymes
    94215 (Ugt2a1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    94215 (Ugt2a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     94215 (Ugt2a1)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   94215 (Ugt2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 E2
AA seq 528 aa AA seqDB search
MLKNILLCSLQISLLGMSLGGNVLIWPMEGSHWLNVKIIIDELLRKEHNVTVLVASGALF
ITPSSISPSLTFEIYPVPFGKEKIESVIKDFVLTWLENRPSPSTIWTFYKEMAKVIEEFH
LVSRGICDGVLKNEKLMSKLQKEKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTV
EKHCGKVPFPPSYVPAILSELTDQMSFTDRVRNFISYRMQDYMFETLWKQWDSYYTKALG
RPTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGE
HGIVVFSLGSMVKNLTDEKANLIASALAQIPQKVLWRYKGKIPDTLGSNTRLFDWIPQND
LLGHPKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMT
SSDLLNALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAH
DLSWFQYHSLDVIGFLLACVASAILLVAKCCLFIFQKVGKTGKKKKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaacattttgctctgttctcttcagataagccttctaggaatgagtcttggt
gggaacgttctcatctggcccatggaaggcagtcactggctaaatgttaagatcataata
gatgaactcctaagaaaagagcataatgtgactgtccttgtggcctccggggcccttttc
atcacaccatcatccatcagcccatctctgacatttgaaatatatccagtgccctttggc
aaggaaaaaattgaaagtgtgatcaaagactttgttttgacatggctggaaaacaggcca
tctccttcaactatctggactttctataaggaaatggccaaagtcattgaggagtttcat
ttggtgtccagaggtatctgtgatggcgttcttaagaatgaaaagctgatgtccaagctt
cagaaagaaaagttcgaagtactgttatcagaccctgtatttccttgtggtgacatcgtg
gctttaaaactgggaattccatttatctattccttgcggttttcccctgcctccacagtg
gaaaagcattgtggaaaggtcccattccctccttcctatgtacctgcaattctgtcagaa
ctcacagaccagatgtccttcactgaccgagtaagaaacttcatttcttaccgaatgcag
gactacatgtttgaaaccctttggaagcagtgggattcctattatactaaagctttagga
agacccaccacactgtgtgagactatggggaaagctgagatttggctaatgcgaacctat
tgggattttgaatttcctcgtccatatttaccgaattttgagtttgtgggaggactgcac
tgcaaacctgccaagcctttacctaaggaaatggaagagtttgtccagacctcaggggaa
catggtattgtggtgttttctctggggtcaatggtcaaaaacctgacagatgaaaaggcc
aatctcattgcctcagcccttgcccagattcctcagaaggttttgtggcgatacaaagga
aagataccagacacattaggatccaatacaagactgtttgattggattcctcagaatgat
cttcttggacatcccaaaaccagagcttttatcacccatggtggaacaaatggaatctat
gaggctatttaccatgggatccctatggtgggagtgcccatgttcgctgaccagcctgac
aacattgctcacatgaaggccaaaggagcagcagtggaggtgaacatgaacacgatgaca
agctcagatctgctcaatgctctgagaacagtcatcaatgagccatcttataaagagaat
gccatgagactatcaagaatccaccatgaccagccagtgaagcccctggaccgagcagtc
ttctggattgagtttgtcatgcgtcacaaaggagccaagcaccttcgtgtggcagcccat
gacctcagctggtttcagtaccactctctggatgtaattgggtttctgctggcctgtgtg
gcatctgctatattattggttgcaaaatgttgtttgtttatatttcaaaaagttggtaag
acaggaaagaagaaaaaacgtgactag

DBGET integrated database retrieval system