KEGG   Mus musculus (mouse): 97212Help
Entry
97212             CDS       T01002                                 

Gene name
Hadha, C77020, Mtpa
Definition
hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit (EC:4.2.1.17 1.1.1.211)
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
mmu  Mus musculus (mouse)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    97212 (Hadha)
   01212 Fatty acid metabolism
    97212 (Hadha)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    97212 (Hadha)
   00650 Butanoate metabolism
    97212 (Hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    97212 (Hadha)
   00071 Fatty acid degradation
    97212 (Hadha)
   01040 Biosynthesis of unsaturated fatty acids
    97212 (Hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    97212 (Hadha)
   00310 Lysine degradation
    97212 (Hadha)
   00380 Tryptophan metabolism
    97212 (Hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    97212 (Hadha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     97212 (Hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     97212 (Hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 B1; 5
AA seq 763 aa AA seqDB search
MVASRAIGSLSRFSAFRILRSRGCICRSFTTSSALLTRTHINYGVKGDVAVIRINSPNSK
VNTLNKEVQSEFIEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLSSCTTPQEATRIS
QEGQRMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGIKSPEERTIEYL
EEVAVNFAKGLADRKVSAKQSKGLVEKLTTYAMTVPFVRQQVYKTVEEKVKKQTKGLYPA
PLKIIDAVKAGLEQGSDAGYLAESQKFGELALTKESKALMGLYNGQVLCKKNKFGAPQKN
VQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALP
INQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVK
DGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVA
EDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLR
LPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgtcccgggcgattggcagtctcagtcgcttctctgccttcaggatcctacgc
tccagaggctgcatttgccgcagctttacaacgtcttctgctctgctgaccagaacccat
attaattatggcgtcaaaggggatgtggcagttattcggattaactcacccaattcaaag
gtaaatacattgaataaagaagtacagtcagagttcatagaagtcatgaacgaaatctgg
gccaacgaccaaatcaggagtgctgtccttatctcatcaaagcctggctgctttgtcgca
ggggctgacatcaacatgctatcctcttgtacaaccccccaagaagcaacacgaatatca
caggaaggtcagagaatgtttgagaaacttgaaaagtccccaaagcccgttgtggccgcc
atcagtggatcctgcttgggaggaggacttgagcttgccatagcatgccaatacagaata
gcaacaaaagacagaaaaacagtattaggtgtccctgaagtgttgctggggatcttacca
ggagccggaggtacccagagactgcccaaaatggtgggtgtgcctgctgcatttgacatg
atgctgactggcaggaacattcgtgcagacagagcaaagaaaatgggactggttgaccag
ttggtggaaccgctgggaccaggaataaaatcaccagaagaaaggacaattgaataccta
gaggaagttgcagttaattttgccaaaggcctggctgatcggaaagtctctgcaaagcag
agcaaaggccttgtggaaaagctgacaacgtatgccatgactgtcccatttgtcagacaa
caggtttacaaaacagttgaagaaaaagtgaagaagcagactaaaggcctttatcctgcc
cctttgaaaataattgatgctgtgaaggctggacttgagcaaggcagtgacgctggttat
cttgctgaatcgcagaaatttggagagcttgcattgaccaaagaatcgaaggccctgatg
gggctttataacggccaggtcctgtgcaagaaaaataaatttggagcaccacagaagaac
gttcagcagctagccatccttggcgcagggctgatgggggctggcattgcccaggtctct
gtggataagggactgaaaactcttcttaaagacaccacagtgacggggctgggccgggga
cagcagcaagtgttcaaagggctgaacgacaaagtgaagaagaaagctctcacatcattt
gaaagggattccatcttcagcaacttgattgggcagctggattacaaaggctttgagaag
gccgacatggtgattgaggctgtgtttgaggacctcggtgtaaagcacaaagtgttaaag
gaagtggaaagcgtgactccagaacactgtatctttgccagcaacacatctgctctccca
atcaatcaaattgctgctgtcagcaaaaggcctgagaaggtgatcggcatgcactacttc
tcccccgtggacaagatgcagctcctagaaatcatcaccactgacaaaacctccaaggac
acaacggcctctgccgtggccgtggggctcaggcaagggaaggtcatcattgtggtcaag
gacggacccggcttctacaccaccaggtgtcttgcacccatgatgtctgaagtcatgcga
atcctccaggaaggagttgaccctaagaagctggacgccttgaccacaggtttcggcttc
cctgtgggtgctgccacgctggcagacgaagtgggtgtggatgtagcacagcacgtagca
gaagatctaggcaaagcctttggggagcgatttggaggtggcagcgtagaactgctgaaa
cagatggtctccaagggcttcttaggtcgcaagtctgggaagggcttttacatctatcag
gagggctcaaagaataagagtttgaattctgaaatggataatatcttggcaaatctgagg
ctgcctgccaagcccgaggtctcctctgatgaagacgtccaataccgtgtgataacaagg
ttcgtgaacgaggcagtcctgtgcctacaggaagggatcctggccacaccggcagaggga
gacatcggagctgtctttgggcttggctttcccccttgtctcggagggcccttccgcttt
gtggatctgtatggtgctcagaaggtagtggaccggctacggaagtacgagtctgcctat
ggaacacagtttaccccatgccagctgctcctcgaccacgctaacaactctagcaagaag
ttctaccagtga

DBGET integrated database retrieval system