KEGG   Mus musculus (mouse): 98267Help
Entry
98267             CDS       T01002                                 

Gene name
Stk17b, 3110009A03Rik, AI120141, Drak2
Definition
(RefSeq) serine/threonine kinase 17b (apoptosis-inducing) (EC:2.7.11.1)
  KO
K08804  
serine/threonine kinase 17 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     98267 (Stk17b)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  DAPK family
   98267 (Stk17b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C1.1
AA seq 372 aa AA seqDB search
MSRRRFDCRSVSGLLTTTPQTPIKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYA
AKSLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYENATEIILVLEYAAGGEIFN
LCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDF
GMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDN
QETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGS
LFHPEETSGSSQIQDLTLRSSEEKTSKSSCNGSCGAREDKENIPEDGSLVSKRFRFDDSL
PSPHELVPDLFC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggaggagattcgattgccgaagtgtctcaggcttgctaactacaacccctcaa
acgccgattaaaacagagaattttaataatttctatactcttaccccaaaagaacttggg
agaggaaaatttgctgtggttagacaatgtatatcaaaatcaactggacaagagtatgct
gccaaatccctgaaaaagaggagaagagggcaggattgccgggcggaaattctgcatgag
atagctgtgctggagctggccaggtcttgtccccacgtgattaatctgcatgaggtctac
gaaaatgcaacggaaatcattttggtgttagaatatgctgcgggtggagaaattttcaac
ctgtgtttacctgagttagccgaaatggtatctgaaaatgatgttatcagactcattaaa
caaatccttgaaggagttcattatctacatcagaataacattgttcaccttgatttaaag
ccacagaatatacttttgagcagtatatacccactcggggacataaaaattgtagatttt
ggaatgtctcgaaaaattgggaatgcaagtgagcttcgggaaatcatgggaacacctgaa
tacttagctccagaaatcctcaactatgatcccattaccacagcaacagatatgtggaat
attggcataatagcgtatatgttgttaactcatacatcaccatttgtaggagaagataat
caagaaacatatctgaatatttctcaagtgaatgtagattattcagaagaaatgttttca
tcagtttcacagctggccacagacttcatccagagccttctagtaaagaacccagagaaa
agaccaacagcagaatcctgcctatcccactcatggctgcagcagtgggactttggaagc
ttgtttcatcctgaggaaacttcaggctcctctcaaattcaggatctgactctcaggtcc
tctgaagagaagacctccaagtcctcctgtaatgggagctgtggagcccgggaggacaag
gagaacatccctgaagatggcagcttagtttctaaaagatttcgattcgatgactccttg
cccagcccccatgaacttgttccagatttgttctgttag

DBGET integrated database retrieval system