KEGG   Mus musculus (mouse): 98758Help
Entry
98758             CDS       T01002                                 

Gene name
Hnrnpf, 4833420I20Rik, AA407306, Hnrpf
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein F
  KO
K12898  
heterogeneous nuclear ribonucleoprotein F/H
Organism
mmu  Mus musculus (mouse)
Brite
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    98758 (Hnrnpf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6; 6 F1
AA seq 415 aa AA seqDB search
MMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVE
LESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPF
GCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRY
IEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLDRMRSGAYSAGY
GGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKA
TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELF
LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgggccctgagggaggtgaaggctatgtggtcaaactccgtggcctaccctgg
tcctgctcaattgaggacgtacaaaacttcctctccgactgcacaattcatgatggggtc
gcaggtgttcatttcatttatactagagaaggcaggcagagtggtgaggcttttgttgaa
cttgagtcagaagatgatgtaaaattggctctgaaaaaagacagggaaagcatgggacac
cggtatattgaggtgttcaagtcacacagaaccgagatggattgggtgttgaagcacagt
ggtccaaacagcgccgacagtgccaatgatggctttgtgaggcttcggggactcccattt
ggatgcacaaaggaagaaatcgttcagttcttctcagggttggaaattgtgccaaacggg
atcacactacctgtggacccggaaggcaagattacaggggaggccttcgttcagtttgcc
tcacaagagttagctgagaaagctttagggaagcacaaggagagaatagggcacaggtat
attgaagtgtttaagagcagtcaggaggaagttagatcatactcagatccacctctgaag
tttatgtctgtgcaaaggcctgggccttatgacaggcctggcacagcccggaggtacatt
ggcattgtgaaacaggcaggtctggataggatgaggtctggtgcctatagtgcaggctat
gggggctatgaagaatacagtggcctcagtgatggctatggcttcaccactgacctgttt
gggagagacctcagctattgtctctcaggaatgtatgaccacagatatggagacagcgag
ttcacagtgcagagcaccaccggccactgcgtccacatgagagggctgccctacaaagca
acggagaacgacatttacaacttcttctctccactcaaccctgtgagagttcatattgag
attggtcctgatggaagagtgacgggagaagctgatgttgagtttgctactcatgaagaa
gcagtggcagctatgtccaaggacagggccaacatgcagcacagatacatagaactcttc
ctgaattcaacaacaggggctagcaatggggcttatagcagccaggtgatgcagggcatg
ggcgtgtcagctgcccaggcaacttacagtggcctggagagccagtcagtgagtggctgt
tacggggccggctacagcggtcagaacagcatgggcggatatgattag

DBGET integrated database retrieval system