KEGG   Mus musculus (mouse): 98932Help
Entry
98932             CDS       T01002                                 

Gene name
Myl9, AI327049, MLC20, Mylc2c, RLC-C
Definition
myosin, light polypeptide 9, regulatory
Orthology
K12755  
myosin regulatory light chain 9
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    98932 (Myl9)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    98932 (Myl9)
  Cell communication
   04510 Focal adhesion
    98932 (Myl9)
   04530 Tight junction
    98932 (Myl9)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    98932 (Myl9)
  Endocrine system
   04921 Oxytocin signaling pathway
    98932 (Myl9)
  Circulatory system
   04270 Vascular smooth muscle contraction
    98932 (Myl9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   98932 (Myl9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H1; 2
AA seq 172 aa AA seqDB search
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaagagagccaaggccaagaccaccaagaagaggccccagagggctacgtcc
aatgtcttcgccatgtttgaccagtcccagatccaggagtttaaggaggccttcaacatg
attgatcagaaccgagatggcttcattgataaggaggacctgcacgacatgctggcctct
ctggggaagaaccccacagacgagtatctggagggcatgatgaacgaggcgccagggccc
atcaacttcaccatgttcctcacaatgtttggggagaagctgaacggcacagaccccgag
gatgtgatccgcaatgcctttgcctgctttgatgaggaggcctcaggcttcatccacgag
gaccacctgagggagctgctcaccaccatgggcgaccgattcacggatgaggaggtggac
gagatgtaccgcgaggcacccattgataagaagggcaacttcaactacgtggagttcact
cgcatcctcaaacacggcgccaaggacaaggacgactaa

DBGET integrated database retrieval system