KEGG   Mus musculus (mouse): 98932Help
Entry
98932             CDS       T01002                                 

Gene name
Myl9, AI327049, MLC20, Mylc2c, RLC-C
Definition
myosin, light polypeptide 9, regulatory
Orthology
K12755  
myosin regulatory light chain 9
Organism
mmu  Mus musculus (mouse)
Pathway
Vascular smooth muscle contraction
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Cellular Processes; Cell communication; Tight junction [PATH:mmu04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:mmu04670]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:mmu04921]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mmu04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H1; 2
AA seq 172 aa AA seqDB search
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaagagagccaaggccaagaccaccaagaagaggccccagagggctacgtcc
aatgtcttcgccatgtttgaccagtcccagatccaggagtttaaggaggccttcaacatg
attgatcagaaccgagatggcttcattgataaggaggacctgcacgacatgctggcctct
ctggggaagaaccccacagacgagtatctggagggcatgatgaacgaggcgccagggccc
atcaacttcaccatgttcctcacaatgtttggggagaagctgaacggcacagaccccgag
gatgtgatccgcaatgcctttgcctgctttgatgaggaggcctcaggcttcatccacgag
gaccacctgagggagctgctcaccaccatgggcgaccgattcacggatgaggaggtggac
gagatgtaccgcgaggcacccattgataagaagggcaacttcaactacgtggagttcact
cgcatcctcaaacacggcgccaaggacaaggacgactaa

DBGET integrated database retrieval system