KEGG   Mus musculus (mouse): 99011Help
Entry
99011             CDS       T01002                                 

Gene name
Pomt1, AI505244
Definition
protein-O-mannosyltransferase 1 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mmu  Mus musculus (mouse)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    99011 (Pomt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     99011 (Pomt1)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   99011 (Pomt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 B; 2
AA seq 746 aa AA seqDB search
MGSHSTGLEETLGVLPSWLFCKMLRFLKRPLVVTVDINLNLVALTGLGLLTRLWQLSYPR
AVVFDEVYYGQYISFYMKRIFFLDDSGPPFGHMLLALGGWLGGFDGNFLWNRIGAEYSSN
VPIWSLRLLPALAGALSVPMAYQIVLELHFSHGAAIGAALLMLIENALITQSRLMLLESI
LIFFNLLAVLSYLKFFNSQTHSPFSVHWWLWLLLTGVSCSCAVGIKYMGIFTYLLVLGIA
AVHAWNLIGDQTLSNMRVLSHLLARIVALLVVPVFLYLLFFYVHLMLLYRSGPHDQIMSS
AFQASLEGGLARITQGQPLEVAFGSQVTLKSVSGKPLPCWLHSHKNTYPMIYENGRGSSH
QQQVTCYPFKDINNWWIVKDPGRHQLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAP
LSPHSQEVSCYIDYNISMPAQNLWKLDIVNRESNRDTWKTILSEVRFVHVNTSAILKLSG
AHLPDWGFRQLEVVGEKLSPGYHESMVWNVEEHRYGKSHEQKERELELHSPTQLDISRNL
SFMARFSELQWKMLTLKNEDLEHQYSSTPLEWLTLDTNIAYWLHPRTSAQIHLLGNIVIW
TSASLATVVYTLLFFWYLLRRRRSICDLPEDAWSRWVLAGALCTGGWALNYLPFFLMERV
LFLYHYLPALTFQILLLPIVLQHASDHLCRSQLQRNVFSALVVAWYSSACHVSNMLRPLT
YGDTSLSPGELRALRWKDSWDILIRK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggggagccactctacgggactcgaagaaacgctcggagtcctcccgagctggcttttc
tgcaaaatgttaagatttttgaaacggcctctagtggtgactgttgacatcaatttgaac
ttggtagctctgactggcctgggactacttacccgactatggcaactctcctaccctcgg
gctgtggttttcgatgaagtatattatgggcagtacatttccttctacatgaagcgcatc
ttctttctggatgacagtgggccaccatttggccacatgctactggccttaggaggttgg
ttagggggattcgatggtaactttctgtggaaccgaattggagcagagtacagtagcaat
gtgcctatatggtccttacgcctgctgccagcgcttgccggggccctgtcagtgcccatg
gcctaccagatagtgctagagctccacttttcccacggtgctgccattggagccgccctg
ctgatgctcattgagaacgccctgatcactcagtccaggctcatgctgttggagtccata
ctgatattttttaacctgttggctgtgttgtcctatctgaagttcttcaactcccagaca
cacagccctttctcagtgcactggtggctgtggctactgctgaccggggtctcttgttcc
tgtgcagttgggatcaaatacatggggattttcacctacctgcttgtgctcggcattgca
gctgtccacgcgtggaatctgatcggagaccagaccttgtcaaatatgcgcgtgctcagt
cacttgctcgccagaatcgtggctctgctggtcgtcccagtcttcctgtacttactcttc
ttctatgtccacctgatgctgctctaccgctctgggccccatgaccaaatcatgtccagt
gccttccaggccagcttggagggagggcttgcccgcatcacccaaggccagcccctggag
gtggcctttggttcccaggtcactctgaagagcgtctctggcaaacccttgccctgctgg
cttcattcgcacaagaacacctatcccatgatatatgagaatggccgtggcagctcccac
cagcaacaggtgacctgttatcccttcaaagacatcaataactggtggatcgtcaaggat
cctgggcgacaccagctggtggtaaacaaccctccccggcctgtaagacatggagacatt
gtacagctcgttcacggcatgaccacccgcctccttaacacgcacgatgtcgcagcccca
ctgagcccccattctcaagaagtctcctgctacattgactataacatctccatgcctgcc
cagaacctctggaaactggacattgtgaacagagagtccaaccgggatacctggaagact
atcttgtcggaagtgcgctttgtacatgtgaacacatccgccatcttgaagctgagcggg
gctcacctccctgactgggggttccggcagttggaggtagttggggagaagttgtcaccg
ggctaccacgagagcatggtgtggaatgtggaagaacaccggtatggcaaaagccatgag
cagaaggagagggagctggagctccactcgcccactcagctcgatatcagcaggaacctc
agcttcatggccagattctcagagttacagtggaagatgctgacgctgaagaatgaggac
ttggaacaccagtacagctccaccccgctggagtggctcacgctggacaccaacatcgcc
tattggctacatcccaggaccagtgctcagatccacttgcttgggaacattgtgatctgg
acttcagccagccttgccacagtggtctacactctactcttcttctggtacctgctccgc
cggcgaaggagcatctgtgacctccctgaggatgcctggtcccgctgggtgctggctgga
gccctgtgtactggcggctgggcactcaactacctgcccttcttcctgatggagagggtg
ctcttcctctaccactacttgccggcactcaccttccagatcctgctgctcccgattgtc
ctgcagcacgccagcgaccatctgtgcaggtcccagctgcagaggaatgtcttcagtgcc
ctggttgtagcatggtattcctccgcatgccatgtgtccaacatgctacgcccactaacc
tatggggacacgtcactctcaccaggcgagctccgggcccttcgctggaaagacagctgg
gatattctgatccgaaagtaa

DBGET integrated database retrieval system