KEGG   Mus musculus (mouse): 99982Help
Entry
99982             CDS       T01002                                 

Gene name
Kdm1a, 1810043O07Rik, AA408884, Aof2, D4Ertd478e, Kdm1, Lsd1, mKIAA0601
Definition
(RefSeq) lysine (K)-specific demethylase 1A
  KO
K11450  
lysine-specific histone demethylase 1A [EC:1.-.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     99982 (Kdm1a)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    99982 (Kdm1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D3; 4 68.8 cM
AA seq 853 aa AA seqDB search
MLSGKKAAAAAAAAAAAAAAGTEAGSGAAGGAENGSEVAAPPAGLTGPTDMATGAAGERT
PRKKEPPRASPPGGLAEPPGSAGPQAGPTAGPGSATPMETGIAETPEGRRTSRRKRAKVE
YREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAF
QSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLE
APYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPIKKTGKVIIIGSGVSGLAAARQLQS
FGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQK
CPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQ
EKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFL
VKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFA
NATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASG
CEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNL
NKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENIS
DDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQP
ITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQ
ATPGVPAQQSPSM
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctgggaagaaggcggcggcggcggcagcggcagcggcggcggcggcggctgct
gggaccgaggccgggtccggggcggcgggcggtgccgagaacggctctgaggtggccgcg
ccgcccgcgggcctgacgggccccaccgacatggctacgggggcggcgggcgagcgcact
ccccgaaagaaggagcctccgcgggcctcgccgcccgggggcctagccgagccgccgggg
tctgctgggccccaggcggggcccacagccgggcccggctccgcgacgcccatggagacc
ggaatagccgagaccccggagggccgacggaccagccggcgcaagcgggccaaggtagaa
tacagagaaatggatgaaagcttggccaacctctcagaagatgaatattattcggaagaa
gaaagaaatgctaaagcagagaaggaaaagaagcttcccccaccacctcctcaagcccca
cctgaggaagaaaatgaaagtgagccggaagagccgtctggtgtggagggtgcagctttt
caaagccgacttccccatgaccgaatgacctctcaggaagcagcctgtttcccagacatc
atcagtgggcctcagcagacacagaaggtttttctgttcatcaggaatcgcacattgcag
ttatggctggacaacccaaagatccagctgacgtttgaagccactctccagcagctggaa
gcgccttacaacagcgatactgtgcttgtccaccgagttcacagttacttagagcgccat
ggtcttatcaacttcggcatctacaagaggataaaacccttaccaattaaaaagacagga
aaggtgattattataggttcaggtgtttctggcttggcagcagctcgacagctacagagt
tttgggatggatgtcacacttctggaagccagggatcgagtaggtggacgagttgctaca
tttcgaaaaggaaactatgtagctgatcttggcgccatggttgtaacaggtcttggaggg
aatcccatggctgtcgtcagcaaacaagtaaatatggaactggccaagatcaagcaaaaa
tgcccactttatgaagccaatggacaagctgttccaaaagaaaaagatgaaatggtagaa
caagaatttaaccggttgctagaagccacttcttaccttagtcaccagttagacttcaac
gtcctcaataataaacctgtatcccttggccaggcattggaggttgtcattcagctgcaa
gaaaagcatgtcaaagatgagcagattgaacattggaagaagatagtgaaaactcaggag
gagttgaaagagcttcttaataagatggtaaatttgaaggagaaaattaaagagctccat
cagcaatacaaagaagcttcagaagtgaagccgcccagagatatcacagccgagttcctg
gtgaagagcaagcacagggacctgactgccctctgcaaggaatatgatgaattagctgaa
acacaaggaaagctagaagaaaaacttcaagaattggaagccaatcccccaagtgatgta
tacctctcatcaagagacagacaaatacttgactggcattttgcaaatcttgaatttgcc
aacgccacacctctctctaccctctctcttaaacattgggatcaggatgatgactttgag
tttactggaagccacctgacagtaaggaatggctactcatgtgtgcctgtggctttagct
gaaggcttggacattaaactgaacacagcagtgcggcaggttcgctacacagcctcagga
tgtgaagtgattgctgtgaacacacgttccacaagtcaaacctttatttataagtgtgat
gcagttctctgtacacttcctttgggagtgttgaagcagcagccaccagctgttcagttt
gtgccacctcttcctgagtggaaaacatctgcagtccaaaggatgggatttggcaacctt
aacaaggtggtgttatgctttgaccgtgtgttctgggacccaagtgtcaatttgtttggg
cacgttggcagtacaactgctagcaggggtgagctcttcctcttctggaacctatataaa
gctccaatactattggccctggtagcaggagaagctgctggcattatggagaacattagt
gatgatgtgattgtcggccggtgcctggccattctcaaagggatttttggcagcagtgca
gtcccacagcccaaggaaactgtggtatctcgttggcgtgctgatccgtgggcccggggc
tcctattcttatgtggctgcaggatcctctggaaatgactatgatttaatggctcagccg
atcactcctggcccctcaattccaggtgccccacagccaatcccaagactcttctttgct
ggagaacacacaatccggaactacccagctacagtccatggtgctctgttgagtgggctt
cgagaagcaggaaggattgccgaccagtttttgggagccatgtacactttgcctcgtcag
gccacaccaggtgtccctgcacagcagtccccaagtatgtga

DBGET integrated database retrieval system