KEGG   Mus musculus (mouse): 107971Help
Entry
107971            CDS       T01002                                 

Gene name
Frs3, 4930417B13Rik, AI449674, Frs2beta, Snt2
Definition
(RefSeq) fibroblast growth factor receptor substrate 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 107971
NCBI-ProteinID: NP_659188
MGI: 2135965
Ensembl: ENSMUSG00000023266
Vega: OTTMUSG00000018351
UniProt: Q91WJ0
Position
17; 17 C
AA seq 492 aa AA seqDB search
MGSCWSCLDRDSVPHNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHQREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEDIFNLLQDLMQCNSINVTEEPVIIT
RSSHPPELDLPRGPPQPAGYTVSGFSNGFPGCPGEGPRFSSAPRRPSTSSLRHPSPGEES
THTLIASEEQSHTYVNTPTGDEDGRSRHCLQPLPEGRVPLPAQTQGSDQRDPQVLLQPGQ
VKFVLGPTPARRQVMKCQSLCPGMQDPPHHNNNEGPSECPAQPKCTYENVSGGLQQGAGW
RLSPEERGWSGLAHRRAALLHYENLPPLPPVWESQGQQPGGEAGDDGDSRDGLTPSSNGF
PDGEEDETPLQKPTSTRASARSHSGFPVPLTRRRGSPRVFNFDFRRQGPEPPRQLNYIQV
ELKGWGTARPKGPQNPSVSGAPGPTPHPVRSSDSYAVIDLKKTAAMSDLQRALPRDDGAV
RKTRHNSTDLPL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggggagctgctggagctgcctggacagagacagcgtgccgcacaaccaccctaccaag
ttcaaggtgaccaatgtggatgatgaaggggtggagttgggctcgggggtgatggagctg
acccagagtgagctggtgctacacctgcaccagcgggaagctgtccgctggccctacctc
tgcctgcggcgctatggctacgactccaatctcttctcctttgagagtggccgccgctgt
cagacaggccagggcatctttgcattcaagtgttcgagggcagaggacatcttcaacctg
ctgcaggacctcatgcagtgtaacagcatcaacgtgacggaggagccggtcatcatcacg
cggagcagccacccaccagagctggacctgcctcgagggcccccacagcccgctggctac
acggtctctggcttctccaatggcttccctggctgccctggagagggcccacggttctcc
tccgcacctcgccgaccctccacaagcagtctgcgacacccctcgcctggggaagagtct
acccacaccctcattgcctccgaggagcagtctcacacctatgtcaacacaccaactggg
gatgaggatggcagaagtcgccactgcctgcagccactgcctgagggcagggtacccctc
ccagcacagacacagggttccgaccagcgagacccacaggtgttgctccagccagggcag
gtcaagttcgtgctgggccccacccctgctcggcggcaggtgatgaagtgccagagcctc
tgcccgggcatgcaggaccctccccatcacaacaacaacgagggcccttctgagtgccca
gcccagcccaaatgcacctacgagaacgtcagcgggggcctgcagcaaggggctggctgg
agactgagccctgaggagcgagggtggagtggcctggcccaccgtcgggcggccctgctg
cactatgagaacctgcccccacttcccccagtgtgggagagccaaggtcaacagccggga
ggggaggctggggatgatggggactccagggacgggcttaccccgtcctcaaatggcttc
cctgatggcgaggaggatgaaaccccgctacagaaacccaccagcacgcgggcctccgcc
cgtagccacagcggcttccctgtcccactgacccgccgacgaggctccccgcgggtcttc
aactttgatttccgccggcagggccctgagcccccaaggcagctcaactacatccaggtg
gagctcaagggctggggtacagcccgtcccaaggggccccagaacccctcagtgtctgga
gctcctgggcccaccccacaccctgttcgcagctcagactcgtatgccgtgattgacctc
aagaaaacggcggccatgtccgacctgcagagggctctgccccgagatgatggcgcggtc
aggaagactcggcacaacagcaccgacctgcctctgtag

DBGET integrated database retrieval system