KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0168Help
Entry
MYCMA_0168        CDS       T02177                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MYCMA_0168 (recR)
DNA repair and recombination proteins [BR:mmv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MYCMA_0168 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322072..322680
Genome map
AA seq 202 aa AA seqDB search
MFEGPVQDLIDELGKLPGVGPKSAQRIAFHLLGVEAPDIDRLTAALTRVRDGVQFCEVCG
NVSDKERCRICADPRRDIALVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLTRIGTEEDGVSISEVIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPM
GGDLEFADELTLGRALSGRRPL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagggcccggtccaggacctcattgacgagctgggcaagctgcccggggtaggg
cccaagagcgcgcagcgcatcgcattccatttgttgggtgtcgaggcgcccgatatcgat
cgactgaccgcggcactgacgagggtgcgcgacggcgttcagttctgcgaggtgtgcggg
aacgtctccgataaggagcgttgccgcatctgtgccgatccgcgccgtgatatcgcgctg
gtctgcgttgtcgaggaacccaaggatgtgcaggcggtcgaacgcacccgtgaattccgg
ggccgctaccacgtactcggcggcgcgctggatccgctctcgggagtcgggcccgatcag
cttcggattcgggagctgttgacccgcataggaaccgaggaggatggggtgtccatctcc
gaggtcatcatcgctaccgacccgaataccgagggcgaggccaccgcgacctacctggtg
cggatgctgcgcgacttccccggactcaccgtcacgcgattggcctccggcctaccgatg
ggcggagacctggaattcgccgatgagctgaccctcggacgtgccctctcgggtcgccgc
cccctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system