KEGG   Mycobacterium massiliense: MYCMA_0168Help
Entry
MYCMA_0168        CDS       T02177                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mmv  Mycobacterium massiliense
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322072..322680
Genome map
AA seq 202 aa AA seqDB search
MFEGPVQDLIDELGKLPGVGPKSAQRIAFHLLGVEAPDIDRLTAALTRVRDGVQFCEVCG
NVSDKERCRICADPRRDIALVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLTRIGTEEDGVSISEVIIATDPNTEGEATATYLVRMLRDFPGLTVTRLASGLPM
GGDLEFADELTLGRALSGRRPL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagggcccggtccaggacctcattgacgagctgggcaagctgcccggggtaggg
cccaagagcgcgcagcgcatcgcattccatttgttgggtgtcgaggcgcccgatatcgat
cgactgaccgcggcactgacgagggtgcgcgacggcgttcagttctgcgaggtgtgcggg
aacgtctccgataaggagcgttgccgcatctgtgccgatccgcgccgtgatatcgcgctg
gtctgcgttgtcgaggaacccaaggatgtgcaggcggtcgaacgcacccgtgaattccgg
ggccgctaccacgtactcggcggcgcgctggatccgctctcgggagtcgggcccgatcag
cttcggattcgggagctgttgacccgcataggaaccgaggaggatggggtgtccatctcc
gaggtcatcatcgctaccgacccgaataccgagggcgaggccaccgcgacctacctggtg
cggatgctgcgcgacttccccggactcaccgtcacgcgattggcctccggcctaccgatg
ggcggagacctggaattcgccgatgagctgaccctcggacgtgccctctcgggtcgccgc
cccctctga

DBGET integrated database retrieval system