KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0266Help
Entry
MYCMA_0266        CDS       T02177                                 

Gene name
folE
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCMA_0266 (folE)
Enzymes [BR:mmv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MYCMA_0266 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536929..537543
Genome map
AA seq 204 aa AA seqDB search
MNSPETAEYNGHPTGHVFDQARAEAAVRELLYAVGEDPDRHGLADTPARVARAYKEIFAG
LYTDPDTVLNTTFDEQHDELVLVKSIPMYSTCEHHLVSFHGVAHVGYIPGQHGRVTGLSK
IARLVDLYAKRPQVQERLTAQIADALVRKLEPRGVIVVVEAEHLCMAMRGVRKPGATTTT
SAVRGQFKRDAASRAEVLDLMMRT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgcccgagacggccgagtacaacggccatccgaccggtcacgtcttcgatcag
gcacgtgccgaggcggcggtccgtgaactgctctatgcggtgggtgaagacccggatcgg
catggcttggcggatacaccggcccgcgtcgcgcgtgcgtacaaggagattttcgccggg
ctctacaccgatccggataccgtgctgaataccaccttcgacgagcagcatgacgagctg
gtcctggtgaagtcgataccgatgtactcgacgtgtgaacatcacctggtgtcgttccat
ggcgtcgcgcatgtcggatatatccccggccagcacggccgtgtcacggggctctcgaaa
atcgctcgcttggttgacctttacgcgaaacggccgcaggtgcaggagcgtctgacagcg
cagatcgccgacgcgctggtgcgcaagctcgagccgcgcggagtgatcgtcgtggtggaa
gccgagcatctgtgcatggccatgcgcggcgtacgcaagcccggtgcgactaccacgacc
tccgccgtacggggtcagttcaaacgtgacgccgcttcccgggccgaggttctcgacctg
atgatgaggacatga

DBGET integrated database retrieval system