KEGG   Mycobacterium massiliense: MYCMA_0325Help
Entry
MYCMA_0325        CDS       T02177                                 

Definition
acetaldehyde dehydrogenase 1 (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mmv  Mycobacterium massiliense
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mmv00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mmv00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mmv00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mmv00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mmv00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624862..625770
Genome map
AA seq 302 aa AA seqDB search
MASKASVAIVGSGNISTDLLYKLQRSEWLEPRWMIGIDPESEGLKRARGFGLETSHEGVD
WLLGQDEKPDLVFEATSAYVHKAAAPRYEEAGIRAIDLTPAAVGPAVVPPANLRAHLDAP
NVNMITCGGQATIPIVYAVSRVVEVPYAEIVASVASVSAGPGTRANIDEFTKTTSKGVEV
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRAAIAASIHDVVSQVQQYVPGYRLL
NEPQFDEPSVVNGGNHVVTTFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAKELLSAK
VS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcaaaggcatctgtagcgatcgtcggttcgggaaacatcagcaccgacctgctg
tacaaattgcagcgttccgagtggctggagccgcggtggatgatcggcatcgatcccgag
tccgaaggtctcaagcgtgcccgcggtttcggtctggaaacctcgcacgagggtgtggac
tggttgcttgggcaggacgagaagccggatctggtcttcgaggcaacgtccgcctacgtg
cacaaggccgccgcgccacgctatgaggaagcgggcatccgggccatcgatctgactccc
gcagcggtgggaccggccgttgtgccgcccgcgaatctgcgtgcccaccttgatgctccg
aacgtcaacatgatcacctgcggtggccaggcgacgattccgatcgtgtacgcggtgtcg
cgcgttgtcgaggtgccttacgccgagatcgtcgcctcggtcgcctcggtgtccgcggga
cccggaacgcgcgccaatatcgacgagttcaccaagaccacgtccaagggggtggaggtg
atcggaggcgccaagcgcggaaaggcgatcatcatcctgaaccccgcggatccgccgatg
atcatgcgcgacacaattttctgcgcaattcctgaggacgcggaccgtgcggcgattgcc
gcgtcgattcacgatgtggtgagccaggttcagcagtacgtgcccggataccggctgctc
aatgagccgcagttcgatgagccgtcggtggtcaacggcggcaaccatgtcgtcaccacc
ttcgtcgaggttgagggcgccggtgacttcttgccgccgtatgccggaaacctggacatc
atgaccgcggccgcgaccaaggtcggcgaggaaatcgccaaagaacttctatctgcaaag
gtttcgtga

DBGET integrated database retrieval system