KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0370Help
Entry
MYCMA_0370        CDS       T02177                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00480  Glutathione metabolism
mmv00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MYCMA_0370
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCMA_0370
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MYCMA_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AFN62541
Position
complement(4008270..4008758)
Genome map
AA seq 162 aa AA seqDB search
MTDLASIPLTALDGSALSLADFGDNTVLVVNVASKCGLTPQYTALEKLASDYADRGLTVL
GVPCNQFMGQEPGTAEEIREFCSTTYGVSFPLLEKTDVNGDNRHPLYAELIKTADAEGTA
GDVQWNFEKFLIARDGSVVNRFRPTTVPDAPEVIAAIEKELG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgcgtccatcccgttgaccgccctggacggctctgcgctgtcacttgcc
gatttcggcgataacaccgtcctggtggtcaacgtcgcgtccaagtgcggtctcaccccg
cagtacacggccctggagaagctggcctccgactacgccgaccgtggtctgaccgtgctc
ggggttccctgtaaccaattcatggggcaggaaccgggcacggcggaggaaattcgggag
ttctgctccactacctatggggtgagtttcccgctgctggagaagaccgatgtgaacggt
gacaatcggcatccgctgtacgcggagctcatcaagaccgccgatgcggagggtaccgcg
ggtgatgtgcagtggaacttcgagaaattcttgattgcgcgggatgggtcggtggtcaat
agattccggccgacaacggtgccggacgcgcccgaggtgatcgcggccatcgagaaggag
ctgggttag

DBGET integrated database retrieval system