KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0437Help
Entry
MYCMA_0437        CDS       T02177                                 

Gene name
fadJ
Definition
Fatty acid oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCMA_0437 (fadJ)
   01212 Fatty acid metabolism
    MYCMA_0437 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCMA_0437 (fadJ)
   00650 Butanoate metabolism
    MYCMA_0437 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    MYCMA_0437 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    MYCMA_0437 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCMA_0437 (fadJ)
   00310 Lysine degradation
    MYCMA_0437 (fadJ)
   00380 Tryptophan metabolism
    MYCMA_0437 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCMA_0437 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYCMA_0437 (fadJ)
   00281 Geraniol degradation
    MYCMA_0437 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MYCMA_0437 (fadJ)
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MYCMA_0437 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYCMA_0437 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MYCMA_0437 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845885..848044
Genome map
AA seq 719 aa AA seqDB search
MSANTIQWEKDADGIVTVTLDDPNGSANVMNDDYKQSMAATVKRLVEEKDSITGVVITSA
KKTFFAGGDLTKIIQIQPENAQEAFNEVEEIKADLRTLETFGRPVVAAINGAALGGGLEI
ALATHHRIAADVKGSQIGLPEVSLGLLPGGGGVTRVTRMLGIQNGFVTVLAQGTRFNPTK
AKEVGLIDELVGSVDELIPAAKAWIKANPEAVQRWDVKGYKIPGGTPSTPALAAILPSFP
SNLKKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFTSLATGQVAKNMTQAFFFD
LQHINGGGSRPDGIAKQDIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSLEAAQKGKG
YSEKLEEKALSRGKTTQEKSSELLARIHPTADPADLAGVDFVIEAVFENTELKHKVFQEI
EDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDEAL
ARVFDYVLAIKKTPIVVNDSRGFFTSRVIGTFVNEAVAMLAEGIEPATIEQAGSQAGYPA
PPLQLSDELNLTLMQKIRKETAEAAKAEGKELPDDPAGRVIDTLVEAGRPGRLGGAGFYD
YVDGKRTELWPGLRETFKTRNGADPANPPLQDLIERMLFAEAIETQKCFDEGVLTSTADA
NIGSIFGIGFPAWTGGVHQYILGYDGPTGKGKAGFVARAKELAAKYGDRFNPPASLLDA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaacacaattcagtgggagaaggacgccgacggcatcgtcaccgtcaccctg
gacgaccccaacggctcggccaacgtgatgaacgacgactacaagcagtcgatggccgcg
accgtcaagcgccttgtggaagagaaggattcgatcaccggcgtggtgatcaccagcgcc
aagaagaccttcttcgccggtggtgacctgaccaagatcatccagatccagccggagaac
gcccaggaggccttcaacgaggtcgaggagatcaaggccgacctgcgtacgctggagacc
ttcggccgccccgtggtggcggccatcaacggcgccgctctcggcggtggcctggagatc
gcgctggcgacccatcaccggatcgcggccgacgtcaagggatctcagatcggtctgccc
gaggtatcgctgggcctgctgcccggcggcggcggcgtcacccgggttacccgcatgctc
ggtatccagaacggcttcgtgaccgtgctggcgcagggcacccgcttcaacccgactaag
gccaaggaagtcggcctgatcgatgagttggtcggctccgtcgacgagctgatcccggcc
gccaaggcgtggatcaaggccaacccggaggccgtgcagcgctgggatgtcaagggctac
aagatccccggcggcaccccgtcgaccccggcgctggcggccatcctgccgtcgttcccg
tcgaacctgaagaagcagctcaagggtgcgccgatgcccgccccgcgggccatcctggcc
gccgcggtcgagggtgcgcaggtggatttcgacacggccagccgtatcgagagccgttac
ttcaccagcctggccaccggccaggtcgccaagaacatgacgcaggcgttcttcttcgac
ctgcagcacatcaacggcggtggttcacgtccggacggcatcgccaagcaagacatcaag
aagatcggcgtgctgggcgcgggcatgatgggcgccggtatcgcctacgtctcggccaag
gccggttacgacgtcgtgctcaaggatgtctcgctggaggcggctcagaagggcaagggc
tactccgaaaagcttgaagagaaagctctttcgcggggcaagaccacccaggaaaaatcc
agcgaactcctcgcaagaattcacccgactgccgaccctgccgacctggccggtgtcgac
ttcgtgatcgaggccgtcttcgagaacaccgagctcaagcacaaggtgttccaggagatc
gaagacatcgtcgagcccaacgcgctcctgggttccaacacctcgaccctgcccatcacg
gggctggccacgggtgtgaagcgccaggaggacttcatcggtatccacttcttctcgccc
gtggacaagatgccgctggtggagatcatccgcggtgagaagacctcggacgaggcgttg
gcccgggtgttcgactacgtgctggccatcaagaagaccccgatcgtcgtcaatgacagc
cgtggcttcttcaccagccgcgtcatcggcaccttcgtcaacgaggccgtcgccatgctg
gccgagggcatcgagcccgcgacgatcgagcaggccggcagccaggccggatacccggcc
ccgccgctgcagctctccgacgagctgaacctgacgctcatgcagaagatccgcaaggag
acggcggaggctgccaaggccgagggcaaggaactgccggatgacccggccggtcgtgtc
atcgacaccctggttgaggcgggccgccctggccgtctcgggggcgccggtttctacgac
tacgtggacggcaagcgcactgagctgtggcccggcctgcgggagacgttcaagacccgc
aatggcgccgaccccgccaacccgccgctgcaggacctcatcgagcgcatgttgttcgcc
gaggccatcgagacgcagaagtgcttcgatgagggtgtgctgacgtcgaccgccgatgcc
aacatcggttcgatcttcggcatcggcttcccggcctggaccggtggtgtgcaccagtac
atccttgggtacgacggccccaccggaaagggcaaggctggcttcgtcgcccgcgcaaag
gaattggccgccaagtacggtgaccgtttcaacccgcccgcttcgctcttggacgcatag

DBGET integrated database retrieval system