KEGG   Mycobacterium abscessus subsp. bolletii GO 06: MYCMA_0560Help
Entry
MYCMA_0560        CDS       T02177                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmv  Mycobacterium abscessus subsp. bolletii GO 06
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCMA_0560
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCMA_0560
   00640 Propanoate metabolism
    MYCMA_0560
   00660 C5-Branched dibasic acid metabolism
    MYCMA_0560
Enzymes [BR:mmv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MYCMA_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3702260..3703429)
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTTTAEDAKAIAEEIGKPVMIKAQVKVGGRGKAGGVK
YAATPDDAFTHAQNILGLDIKGHIVKKILVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGVEIEVTAEENPDALAKVPVDAVKGVDLALAREIAEKGKLPAEVLDSAAVTIQKLWEVF
VGEDATLVEVNPLVRTPDNQILALDGKVTLDGNADFRQPGHAEFEDKDATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHNGVKPANFLDIGGGASAEVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVGALKTLGDTASKPLVVRLDGNKVEEGRAIL
AEFNHPLVIQAETMDAGADKAAALAAASN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatttattcgagtaccaggccaaggagctgttcgctaagcacaacgtgccgacgacg
ccgggccgggttaccaccaccgccgaggatgccaaggcgatcgccgaagaaatcggcaag
ccggtgatgatcaaggctcaggtcaaggttggtggacgtggcaaggccggtggtgtgaag
tacgccgccacccccgatgacgcatttactcatgcacagaacatcctgggcctggacatc
aagggccacatcgtcaagaagatcctcgtcgccgaggccagcgatatcgccgaggagtac
tacatctccttcctgctggaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggtgtcgagatcgaggtaaccgccgaggagaaccccgacgcactggccaaggtgccc
gttgatgccgtcaagggtgtcgacctggcgctggctcgtgagattgccgagaagggcaag
ttgcccgccgaggtgctggactccgccgcggtgaccatccagaagctgtgggaggtcttc
gtcggcgaggatgccaccctggtggaggtcaacccgctggtgcgtacccccgacaatcaa
atcctggcgctggacggcaaggtcaccctggacggcaacgccgatttccgtcagcccggc
catgccgagttcgaggacaaggacgccaccgatccgctggaactcaaggccaaggagcac
gacctcaactacgtcaagctcgatggtcaggtcggcatcatcggcaacggcgcaggtctg
gtcatgtccaccctggatgtcgtcgcgtacgcgggcgagaaccacaacggcgtgaagccc
gccaacttcctggatatcggtggtggcgcctcggccgaggtgatggctgccggtcttgat
gtcatcctgggtgactcgcaggtcaagagcgtttttgtgaacgtgttcggtggcatcacc
gcatgtgacgcggtggccaacggcatcgtcggcgccctgaagaccctcggtgacacggcc
agcaagccgttggtggttcgtctcgacggcaacaaggtcgaagaaggacgggcgattctg
gccgagttcaatcatccgctggtgatccaggccgagaccatggacgccggtgccgacaag
gcggccgccctggcggccgcgtccaactag

DBGET integrated database retrieval system